MgcRacGAP/RACGAP1 Antibody (1G6) - Azide and BSA Free | Novus Biologicals H00029127-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

MgcRacGAP/RACGAP1 Antibody (1G6) - Azide and BSA Free

catalog :

H00029127-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1G6

reactivity :

human, chicken

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Yang X, Cao X, He P, Li J, Feng M, Zhang Y, et al. Overexpression of Rac GTPase Activating Protein 1 Contributes to Proliferation of Cancer Cells by Reducing Hippo Signaling to Promote Cytokinesis. Gastroenterology. 2018;155:1233-1249.e22 pubmed publisher
Gao K, Zhang Y, Shi Q, Zhang J, Zhang L, Sun H, et al. iASPP-PP1 complex is required for cytokinetic abscission by controlling CEP55 dephosphorylation. Cell Death Dis. 2018;9:528 pubmed publisher
Lawson C, Fan C, Mitin N, Baker N, George S, Graham D, et al. Rho GTPase Transcriptome Analysis Reveals Oncogenic Roles for Rho GTPase-Activating Proteins in Basal-like Breast Cancers. Cancer Res. 2016;76:3826-37 pubmed publisher
Mi S, Lin M, Brouwer Visser J, Heim J, SMOTKIN D, Hebert T, et al. RNA-seq Identification of RACGAP1 as a Metastatic Driver in Uterine Carcinosarcoma. Clin Cancer Res. 2016;22:4676-86 pubmed publisher
Lekomtsev S, Su K, Pye V, Blight K, Sundaramoorthy S, Takaki T, et al. Centralspindlin links the mitotic spindle to the plasma membrane during cytokinesis. Nature. 2012;492:276-9 pubmed publisher
Wang S, Ooi L, Hui K. Upregulation of Rac GTPase-activating protein 1 is significantly associated with the early recurrence of human hepatocellular carcinoma. Clin Cancer Res. 2011;17:6040-51 pubmed publisher
Burkard M, Maciejowski J, Rodriguez Bravo V, Repka M, Lowery D, Clauser K, et al. Plk1 self-organization and priming phosphorylation of HsCYK-4 at the spindle midzone regulate the onset of division in human cells. PLoS Biol. 2009;7:e1000111 pubmed publisher
Wolfe B, Takaki T, Petronczki M, Glotzer M. Polo-like kinase 1 directs assembly of the HsCyk-4 RhoGAP/Ect2 RhoGEF complex to initiate cleavage furrow formation. PLoS Biol. 2009;7:e1000110 pubmed publisher

product information

master code :

H00029127-M01

SKU :

H00029127-M01

product name :

MgcRacGAP/RACGAP1 Antibody (1G6) - Azide and BSA Free

unit size :

0.1 mg

description :

The MgcRacGAP/RACGAP1 Antibody (1G6) - Azide and BSA Free from Novus is a mouse monoclonal antibody to MgcRacGAP/RACGAP1. This antibody reacts with chicken,human. The MgcRacGAP/RACGAP1 Antibody (1G6) - Azide and BSA Free has been validated for the following applications: Western Blot,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence.

target :

MgcRacGAP/RACGAP1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1G6

conjugate :

Unconjugated

host :

Mouse

immunogen :

MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFED
FRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQ
VDVEIKRRQRAEADCEKLERQIQLIREMLMCD
RACGAP1 (AAH32754, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2b Kappa

purity :

IgG purified

species :

Chicken,Human

specificity :

RACGAP1 - Rac GTPase activating protein 1

gene symbol :

RACGAP1

accessionNumbers :

AAH32754

applications :

Western Blot,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

GTPase activating protein, HsCYK-4, ID-GAP, KIAA1478, Male germ cell RacGap, MGCRACGAP, MgcRacGAPrac GTPase-activating protein 1, Rac GTPase activating protein 1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage