OCIL/CLEC2d Antibody (4C7) - Azide and BSA Free | Novus Biologicals H00029121-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

OCIL/CLEC2d Antibody (4C7) - Azide and BSA Free

catalog :

H00029121-M01

quantity :

0.1 mg

price :

519 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4C7

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
de Vicente J, Lequerica Fern xe1 ndez P, Rodrigo J, Rodr xed guez Santamarta T, Blanco Lorenzo V, Prieto Fern xe1 ndez L, et al. Lectin-like Transcript-1 (LLT1) Expression in Oral Squamous Cell Carcinomas: Prognostic Significance and Relationship with the Tumor Immune Microenvironment. Int J Mol Sci. 2024;25: pubmed publisher
Sánchez Canteli M, Hermida Prado F, Sordo Bahamonde C, Montoro Jim xe9 nez I, Pozo Agundo E, Allonca E, et al. Lectin-Like Transcript 1 (LLT1) Checkpoint: A Novel Independent Prognostic Factor in HPV-Negative Oropharyngeal Squamous Cell Carcinoma. Biomedicines. 2020;8: pubmed publisher
Williams K, Eaton H, Jones L, Rengan S, Burshtyn D. Vaccinia virus Western Reserve induces rapid surface expression of a host molecule detected by the antibody 4C7 that is distinct from CLEC2D. Microbiol Immunol. 2016;60:754-769 pubmed publisher
Chalan P, Bijzet J, Huitema M, Kroesen B, Brouwer E, Boots A. Expression of Lectin-Like Transcript 1, the Ligand for CD161, in Rheumatoid Arthritis. PLoS ONE. 2015;10:e0132436 pubmed publisher
Satkunanathan S, Kumar N, Bajorek M, Purbhoo M, Culley F. Respiratory syncytial virus infection, TLR3 ligands, and proinflammatory cytokines induce CD161 ligand LLT1 expression on the respiratory epithelium. J Virol. 2014;88:2366-73 pubmed publisher
Germain C, Meier A, Jensen T, Knapnougel P, Poupon G, Lazzari A, et al. Induction of lectin-like transcript 1 (LLT1) protein cell surface expression by pathogens and interferon-? contributes to modulate immune responses. J Biol Chem. 2011;286:37964-75 pubmed publisher
Germain C, Bihl F, Zahn S, Poupon G, Dumaurier M, Rampanarivo H, et al. Characterization of alternatively spliced transcript variants of CLEC2D gene. J Biol Chem. 2010;285:36207-15 pubmed publisher
Rosen D, Cao W, Avery D, Tangye S, Liu Y, Houchins J, et al. Functional consequences of interactions between human NKR-P1A and its ligand LLT1 expressed on activated dendritic cells and B cells. J Immunol. 2008;180:6508-17 pubmed
Roth P, Mittelbronn M, Wick W, Meyermann R, Tatagiba M, Weller M. Malignant glioma cells counteract antitumor immune responses through expression of lectin-like transcript-1. Cancer Res. 2007;67:3540-4 pubmed

product information

master code :

H00029121-M01

SKU :

H00029121-M01

product name :

OCIL/CLEC2d Antibody (4C7) - Azide and BSA Free

unit size :

0.1 mg

description :

The OCIL/CLEC2d Antibody (4C7) - Azide and BSA Free from Novus is a mouse monoclonal antibody to OCIL/CLEC2d. This antibody reacts with human. The OCIL/CLEC2d Antibody (4C7) - Azide and BSA Free has been validated for the following applications: Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Flow Cytometry,ELISA,Immunohistochemistry,Western Blot.

target :

OCIL/CLEC2d

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4C7

conjugate :

Unconjugated

host :

Mouse

immunogen :

MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLF
FLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPES
WIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQ
ELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ
CLEC2D (AAH19883, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human

specificity :

CLEC2D - C-type lectin superfamily 2, member D

gene symbol :

CLEC2D

accessionNumbers :

AAH19883

applications :

Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Flow Cytometry,ELISA,Immunohistochemistry,Western Blot

USD :

519 USD

alt names :

CLAXLLT-1, C-type lectin domain family 2 member D, C-type lectin domain family 2, member D, C-type lectin related f, Lectin-like NK cell receptor, Lectin-like transcript 1, LLT1Osteoclast inhibitory lectin, OCILmember D

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage