product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
D4S234E Antibody (1C3) - Azide and BSA Free
catalog :
H00027065-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C3
reactivity :
human, rat
application :
western blot, ELISA, immunocytochemistry
more info or order :
citations: 1
product information
master code :
H00027065-M01
SKU :
H00027065-M01
product name :
D4S234E Antibody (1C3) - Azide and BSA Free
unit size :
0.1 mg
description :
The D4S234E Antibody (1C3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to D4S234E. This antibody reacts with human,rat. The D4S234E Antibody (1C3) - Azide and BSA Free has been validated for the following applications: ELISA,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.
target :
D4S234E
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1C3
conjugate :
Unconjugated
host :
Mouse
immunogen :
MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFP
PPDKVVVKTKTEYEPDRKKGKARPPQIAEFTVSITEGVT
ERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFV
LKNTQCIPEGLESYYAEQDSSAREKFYTVINHYNLAKQS
ITRSVSPWMSVLSEEKLSEQETEAAEKSA
D4S234E (AAH01745, 1 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
PPDKVVVKTKTEYEPDRKKGKARPPQIAEFTVSITEGVT
ERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFV
LKNTQCIPEGLESYYAEQDSSAREKFYTVINHYNLAKQS
ITRSVSPWMSVLSEEKLSEQETEAAEKSA
D4S234E (AAH01745, 1 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
IgG purified
species :
Human,Rat
specificity :
D4S234E - DNA segment on chromosome 4 (unique) 234 expressed sequence
gene symbol :
NSG1
accessionNumbers :
AAH01745
applications :
ELISA,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
carboxyterminally EE-tagged neuron-enriched endosomal 21 kDa protein, D4S234Brain neuron cytoplasmic protein 1, DNA segment on chromosome 4 (unique) 234 expressed sequence, NEEP21, neuron-specific protein family member 1, NSG1, P21
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
