This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ISCU Antibody (3B8-1C4)
catalog :
H00023479-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3B8-1C4
reactivity :
human, rat
application :
western blot, ELISA, immunocytochemistry
citations: 1
product information
brand :
Novus
master code :
H00023479-M01
SKU :
H00023479-M01
product name :
ISCU Antibody (3B8-1C4)
unit size :
0.1 mg
seo description :
The ISCU Antibody (3B8-1C4) - Azide and BSA Free from Novus is a mouse monoclonal antibody to ISCU. This antibody reacts with human,rat. The ISCU Antibody (3B8-1C4) - Azide and BSA Free has been validated for the following applications: ELISA,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.
target :
ISCU
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
3B8-1C4
conjugate :
Unconjugated
dilution :
Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA
host :
Mouse
immunogen :
RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLV
GAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSS
LATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLA
EDAIKAALADYKLKQEPKKGEAEKK
NIFUN (AAH11906, 26 a.a. ~ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
GAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSS
LATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLA
EDAIKAALADYKLKQEPKKGEAEKK
NIFUN (AAH11906, 26 a.a. ~ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
IgG purified
species :
Human,Rat
specificity :
NIFUN - NifU-like N-terminal domain containing
gene symbol :
ISCU
accessionNumbers :
AAH11906
applications :
ELISA,Western Blot,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
2310020H20Rik, HML, hnifU, iron-sulfur cluster assembly enzyme ISCU, mitochondrial, iron-sulfur cluster scaffold homolog (E. coli), IscU, IscU iron-sulfur cluster scaffold homolog, IscU iron-sulfur cluster scaffold homolog (E. coli), ISU2, MGC74517, NIFU, NifU-like N-terminal domain containing, NifU-like N-terminal domain-containing protein, NifU-like protein, NIFUN
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
