product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
TDP-43/TARDBP Antibody (2E2-D3) - Azide and BSA Free
catalog :
H00023435-M01
quantity :
0.1 mg
price :
529 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2E2-D3
reactivity :
human, mouse
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
citations: 207
Reference
Mamontova E, Cl xe9 ment M, Sukhanova M, Joshi V, Bouhss A, Rengifo Gonzalez J, et al. FUS RRM regulates poly(ADP-ribose) levels after transcriptional arrest and PARP-1 activation on DNA damage. Cell Rep. 2023;42:113199 pubmed publisher
Ayodeji S, Bao B, Teslow E, Polin L, Dyson G, Bollig Fischer A, et al. Hyperglycemia and O-GlcNAc transferase activity drive a cancer stem cell pathway in triple-negative breast cancer. Cancer Cell Int. 2023;23:102 pubmed publisher
Carmen Orozco R, Tsao W, Ye Y, Sinha I, Chang K, Trinh V, et al. Elevated nuclear TDP-43 induces constitutive exon skipping. bioRxiv. 2023;: pubmed publisher
Koopman M, G xfc ng xf6 rd xfc L, Seinstra R, Hogewerf W, Nollen E. Neuronal overexpression of hTDP-43 in Caenorhabditis elegans mimics the cellular pathology commonly observed in TDP-43 proteinopathies. MicroPubl Biol. 2023;2023: pubmed publisher
Takeuchi T, Maeta K, Ding X, Oe Y, Takeda A, Inoue M, et al. Sustained therapeutic benefits by transient reduction of TDP-43 using ENA-modified antisense oligonucleotides in ALS/FTD mice. Mol Ther Nucleic Acids. 2023;31:353-366 pubmed publisher
Cooper Knock J, Julian T, Feneberg E, Highley J, Sidra M, Turner M, et al. Atypical TDP-43 protein expression in an ALS pedigree carrying a p.Y374X truncation mutation in TARDBP. Brain Pathol. 2023;33:e13104 pubmed publisher
Gelpi E, Baiardi S, Nos C, Dellavalle S, Aldecoa I, Ruiz García R, et al. Sporadic Creutzfeldt-Jakob disease VM1: phenotypic and molecular characterization of a novel subtype of human prion disease. Acta Neuropathol Commun. 2022;10:114 pubmed publisher
Liu T, Woo J, Bukhari M, Wang X, Yan Y, Buosi S, et al. Modulation of synaptic plasticity, motor unit physiology, and TDP-43 pathology by CHCHD10. Acta Neuropathol Commun. 2022;10:95 pubmed publisher
Krach F, Wheeler E, Regensburger M, Boerstler T, Wend H, Vu A, et al. Aberrant NOVA1 function disrupts alternative splicing in early stages of amyotrophic lateral sclerosis. Acta Neuropathol. 2022;: pubmed publisher
Garcia Morato J, Hans F, von Zweydorf F, Feederle R, Els xe4 sser S, Skodras A, et al. Sirtuin-1 sensitive lysine-136 acetylation drives phase separation and pathological aggregation of TDP-43. Nat Commun. 2022;13:1223 pubmed publisher
Harb K, Richter M, Neelagandan N, Magrinelli E, Harfoush H, Kuechler K, et al. Pum2 and TDP-43 refine area-specific cytoarchitecture post-mitotically and modulate translation of Sox5, Bcl11b, and Rorb mRNAs in developing mouse neocortex. elife. 2022;11: pubmed publisher
Jamerlan A, An S. A Microplate-Based Approach to Map Interactions between TDP-43 and α-Synuclein. J Clin Med. 2022;11: pubmed publisher
Pobran T, Forgrave L, Zheng Y, Lim J, Mackenzie I, DeMarco M. Detection and characterization of TDP-43 in human cells and tissues by multiple reaction monitoring mass spectrometry. Clin Mass Spectrom. 2019;14 Pt B:66-73 pubmed publisher
Ximelis T, Marín Moreno A, Espinosa J, Eraña H, Charco J, Hernandez I, et al. Homozygous R136S mutation in PRNP gene causes inherited early onset prion disease. Alzheimers Res Ther. 2021;13:176 pubmed publisher
Liu Y, Kuo H, Chern Y. A system-wide mislocalization of RNA-binding proteins in motor neurons is a new feature of ALS. Neurobiol Dis. 2021;160:105531 pubmed publisher
Krause K, Wulf M, Sommer P, Barkovits K, Vorgerd M, Marcus K, et al. CSF Diagnostics: A Potentially Valuable Tool in Neurodegenerative and Inflammatory Disorders Involving Motor Neurons: A Review. Diagnostics (Basel). 2021;11: pubmed publisher
Pobran T, Yang D, Mackenzie I, DeMarco M. Aptamer-based enrichment of TDP-43 from human cells and tissues with quantification by HPLC-MS/MS. J Neurosci Methods. 2021;363:109344 pubmed publisher
Atkinson R, Fair H, Wilson R, Vickers J, King A. Effects of TDP-43 overexpression on neuron proteome and morphology in vitro. Mol Cell Neurosci. 2021;114:103627 pubmed publisher
Aladesuyi Arogundade O, Nguyen S, Leung R, Wainio D, Rodriguez M, Ravits J. Nucleolar stress in C9orf72 and sporadic ALS spinal motor neurons precedes TDP-43 mislocalization. Acta Neuropathol Commun. 2021;9:26 pubmed publisher
Tanji K, Mori F, Shirai F, Fukami T, Seimiya H, Utsumi J, et al. Novel tankyrase inhibitors suppress TDP-43 aggregate formation. Biochem Biophys Res Commun. 2021;537:85-92 pubmed publisher
Kumar S, Phaneuf D, Julien J. Withaferin-A Treatment Alleviates TAR DNA-Binding Protein-43 Pathology and Improves Cognitive Function in a Mouse Model of FTLD. Neurotherapeutics. 2021;18:286-296 pubmed publisher
Pozzi S, Codron P, Soucy G, Renaud L, Cordeau P, Dutta K, et al. Monoclonal full-length antibody against TAR DNA binding protein 43 reduces related proteinopathy in neurons. JCI Insight. 2020;5: pubmed publisher
Smeltzer S, Quadri Z, Miller A, Zamudio F, Hunter J, Stewart N, et al. Hypusination of Eif5a regulates cytoplasmic TDP-43 aggregation and accumulation in a stress-induced cellular model. Biochim Biophys Acta Mol Basis Dis. 2021;1867:165939 pubmed publisher
Mishra P, Boutej H, Soucy G, Bareil C, Kumar S, Picher Martel V, et al. Transmission of ALS pathogenesis by the cerebrospinal fluid. Acta Neuropathol Commun. 2020;8:65 pubmed publisher
Pourhaghighi R, Ash P, Phanse S, Goebels F, Hu L, Chen S, et al. BraInMap Elucidates the Macromolecular Connectivity Landscape of Mammalian Brain. Cell Syst. 2020;10:333-350.e14 pubmed publisher
Shafei R, Woollacott I, Mummery C, Bocchetta M, Guerreiro R, Bras J, et al. Two pathologically confirmed cases of novel mutations in the MAPT gene causing frontotemporal dementia. Neurobiol Aging. 2020;87:141.e15-141.e20 pubmed publisher
Zhao C, Devlin A, Chouhan A, Selvaraj B, Stavrou M, Burr K, et al. Mutant C9orf72 human iPSC-derived astrocytes cause non-cell autonomous motor neuron pathophysiology. Glia. 2019;: pubmed publisher
Hans F, Glasebach H, Kahle P. Multiple distinct pathways lead to hyperubiquitylated insoluble TDP-43 protein independent of its translocation into stress granules. J Biol Chem. 2020;295:673-689 pubmed publisher
. Activation of the Unfolded Protein Response and Proteostasis Disturbance in Parkinsonism-Dementia of Guam. J Neuropathol Exp Neurol. 2020;79:34-45 pubmed publisher
. MAPT p.V363I mutation: A rare cause of corticobasal degeneration. Neurol Genet. 2019;5:e347 pubmed publisher
Martinez Valbuena I, Valenti Azcarate R, Amat Villegas I, Riverol M, Marcilla I, de Andrea C, et al. Amylin as a potential link between type 2 diabetes and alzheimer disease. Ann Neurol. 2019;86:539-551 pubmed publisher
Miki Y, Foti S, Asi Y, Tsushima E, Quinn N, Ling H, et al. Improving diagnostic accuracy of multiple system atrophy: a clinicopathological study. Brain. 2019;142:2813-2827 pubmed publisher
Girolamo F, Lia A, Annese T, Giannini M, Amati A, D Abbicco D, et al. Autophagy markers LC3 and p62 accumulate in immune-mediated necrotizing myopathy. Muscle Nerve. 2019;60:315-327 pubmed publisher
Cortese A, Simone R, Sullivan R, Vandrovcova J, Tariq H, Yan Y, et al. Biallelic expansion of an intronic repeat in RFC1 is a common cause of late-onset ataxia. Nat Genet. 2019;51:649-658 pubmed publisher
Yin P, Guo X, Yang W, Yan S, Yang S, Zhao T, et al. Caspase-4 mediates cytoplasmic accumulation of TDP-43 in the primate brains. Acta Neuropathol. 2019;137:919-937 pubmed publisher
Kim G, Bolbolan K, Shahidehpour R, Jamshidi P, Gefen T, Ayala I, et al. Morphology and Distribution of TDP-43 Pre-inclusions in Primary Progressive Aphasia. J Neuropathol Exp Neurol. 2019;78:229-237 pubmed publisher
Aizawa H, Yamashita T, Kato H, Kimura T, Kwak S. Impaired Nucleoporins Are Present in Sporadic Amyotrophic Lateral Sclerosis Motor Neurons that Exhibit Mislocalization of the 43-kDa TAR DNA-Binding Protein. J Clin Neurol. 2019;15:62-67 pubmed publisher
Gomez Tortosa E, Baradaran Heravi Y, González Álvarez V, Sainz M, Prieto Jurczynska C, Guerrero López R, et al. Presence of tau astrogliopathy in frontotemporal dementia caused by a novel Grn nonsense (Trp2*) mutation. Neurobiol Aging. 2019;76:214.e11-214.e15 pubmed publisher
Thammisetty S, Pedragosa J, Weng Y, Calon F, Planas A, Kriz J. Age-related deregulation of TDP-43 after stroke enhances NF-κB-mediated inflammation and neuronal damage. J Neuroinflammation. 2018;15:312 pubmed publisher
Steinacker P, Barschke P, Otto M. Biomarkers for diseases with TDP-43 pathology. Mol Cell Neurosci. 2019;97:43-59 pubmed publisher
Neelagandan N, Gonnella G, Dang S, Janiesch P, Miller K, Küchler K, et al. TDP-43 enhances translation of specific mRNAs linked to neurodegenerative disease. Nucleic Acids Res. 2019;47:341-361 pubmed publisher
Vicente Pascual M, Rossi M, G xe1 mez J, Llad xf3 A, Valls J, Grau Rivera O, et al. Variably protease-sensitive prionopathy presenting within ALS/FTD spectrum. Ann Clin Transl Neurol. 2018;5:1297-1302 pubmed publisher
Solomon D, Stepto A, Au W, Adachi Y, Diaper D, Hall R, et al. A feedback loop between dipeptide-repeat protein, TDP-43 and karyopherin-α mediates C9orf72-related neurodegeneration. Brain. 2018;141:2908-2924 pubmed publisher
Ramos Campoy O, Ávila Polo R, Grau Rivera O, Antonell A, Clarimon J, Rojas García R, et al. Systematic Screening of Ubiquitin/p62 Aggregates in Cerebellar Cortex Expands the Neuropathological Phenotype of the C9orf72 Expansion Mutation. J Neuropathol Exp Neurol. 2018;77:703-709 pubmed publisher
Pozzi S, Thammisetty S, Julien J. Chronic Administration of Pimozide Fails to Attenuate Motor and Pathological Deficits in Two Mouse Models of Amyotrophic Lateral Sclerosis. Neurotherapeutics. 2018;15:715-727 pubmed publisher
Andrés Benito P, Gelpi E, Povedano M, Santpere G, Ferrer I. Gene Expression Profile in Frontal Cortex in Sporadic Frontotemporal Lobar Degeneration-TDP. J Neuropathol Exp Neurol. 2018;77:608-627 pubmed publisher
Scherz B, Rabl R, Flunkert S, Rohler S, Neddens J, Taub N, et al. mTh1 driven expression of hTDP-43 results in typical ALS/FTLD neuropathological symptoms. PLoS ONE. 2018;13:e0197674 pubmed publisher
Endo R, Takashima N, Nekooki Machida Y, Komi Y, Hui K, Takao M, et al. TAR DNA-Binding Protein 43 and Disrupted in Schizophrenia 1 Coaggregation Disrupts Dendritic Local Translation and Mental Function in Frontotemporal Lobar Degeneration. Biol Psychiatry. 2018;84:509-521 pubmed publisher
Verheijen B, Oyanagi K, van Leeuwen F. Dysfunction of Protein Quality Control in Parkinsonism-Dementia Complex of Guam. Front Neurol. 2018;9:173 pubmed publisher
Lai C, Liu Y, Lai H, Chen H, Kuo H, Liao Y, et al. The D2 Dopamine Receptor Interferes With the Protective Effect of the A2A Adenosine Receptor on TDP-43 Mislocalization in Experimental Models of Motor Neuron Degeneration. Front Neurosci. 2018;12:187 pubmed publisher
Deshaies J, Shkreta L, Moszczynski A, Sidibé H, Semmler S, Fouillen A, et al. TDP-43 regulates the alternative splicing of hnRNP A1 to yield an aggregation-prone variant in amyotrophic lateral sclerosis. Brain. 2018;141:1320-1333 pubmed publisher
Grames M, Dayton R, Jackson K, Richard A, Lu X, Klein R. Cre-dependent AAV vectors for highly targeted expression of disease-related proteins and neurodegeneration in the substantia nigra. FASEB J. 2018;32:4420-4427 pubmed publisher
Giannoccaro M, Bartoletti Stella A, Piras S, Casalena A, Oppi F, Ambrosetto G, et al. The First Historically Reported Italian Family with FTD/ALS Teaches a Lesson on C9orf72 RE: Clinical Heterogeneity and Oligogenic Inheritance. J Alzheimers Dis. 2018;62:687-697 pubmed publisher
Feneberg E, Gray E, Ansorge O, Talbot K, Turner M. Towards a TDP-43-Based Biomarker for ALS and FTLD. Mol Neurobiol. 2018;55:7789-7801 pubmed publisher
Berson A, Sartoris A, Nativio R, Van Deerlin V, Toledo J, Porta S, et al. TDP-43 Promotes Neurodegeneration by Impairing Chromatin Remodeling. Curr Biol. 2017;27:3579-3590.e6 pubmed publisher
St Amour I, Turgeon A, Goupil C, Planel E, Hébert S. Co-occurrence of mixed proteinopathies in late-stage Huntington's disease. Acta Neuropathol. 2018;135:249-265 pubmed publisher
Gregory J, Whiten D, Brown R, Barros T, Kumita J, Yerbury J, et al. Clusterin protects neurons against intracellular proteotoxicity. Acta Neuropathol Commun. 2017;5:81 pubmed publisher
Borrego Écija S, Morgado J, Palencia Madrid L, Grau Rivera O, Rene R, Hernandez I, et al. Frontotemporal Dementia Caused by the P301L Mutation in the MAPT Gene: Clinicopathological Features of 13 Cases from the Same Geographical Origin in Barcelona, Spain. Dement Geriatr Cogn Disord. 2017;44:213-221 pubmed publisher
Gelpi E, Carrato C, Grau López L, Becerra J, García Armengol R, Massuet A, et al. Incidental neuronal intermediate filament inclusion pathology: unexpected biopsy findings in a 37-year-old woman with epilepsy. Neuropathol Appl Neurobiol. 2017;43:636-640 pubmed publisher
Chang J, Morton D. Drosophila lines with mutant and wild type human TDP-43 replacing the endogenous gene reveals phosphorylation and ubiquitination in mutant lines in the absence of viability or lifespan defects. PLoS ONE. 2017;12:e0180828 pubmed publisher
Moreno F, Indakoetxea B, Barandiaran M, Caballero M, Gorostidi A, Calafell F, et al. The unexpected co-occurrence of GRN and MAPT p.A152T in Basque families: Clinical and pathological characteristics. PLoS ONE. 2017;12:e0178093 pubmed publisher
Ash P, Stanford E, Al Abdulatif A, Ramirez Cardenas A, Ballance H, Boudeau S, et al. Dioxins and related environmental contaminants increase TDP-43 levels. Mol Neurodegener. 2017;12:35 pubmed publisher
Becker L, Huang B, Bieri G, Ma R, Knowles D, Jafar Nejad P, et al. Therapeutic reduction of ataxin-2 extends lifespan and reduces pathology in TDP-43 mice. Nature. 2017;544:367-371 pubmed publisher
Koriath C, Bocchetta M, Brotherhood E, Woollacott I, Norsworthy P, Simon Sanchez J, et al. The clinical, neuroanatomical, and neuropathologic phenotype of TBK1-associated frontotemporal dementia: A longitudinal case report. Alzheimers Dement (Amst). 2017;6:75-81 pubmed publisher
Wang W, Arakawa H, Wang L, Okolo O, Siedlak S, Jiang Y, et al. Motor-Coordinative and Cognitive Dysfunction Caused by Mutant TDP-43 Could Be Reversed by Inhibiting Its Mitochondrial Localization. Mol Ther. 2017;25:127-139 pubmed publisher
van der Zee J, Gijselinck I, Van Mossevelde S, Perrone F, Dillen L, Heeman B, et al. TBK1 Mutation Spectrum in an Extended European Patient Cohort with Frontotemporal Dementia and Amyotrophic Lateral Sclerosis. Hum Mutat. 2017;38:297-309 pubmed publisher
Redaelli V, Rossi G, Maderna E, Kovacs G, Piccoli E, Caroppo P, et al. Alzheimer neuropathology without frontotemporal lobar degeneration hallmarks (TAR DNA-binding protein 43 inclusions) in missense progranulin mutation Cys139Arg. Brain Pathol. 2018;28:72-76 pubmed publisher
Dutta K, Patel P, Rahimian R, Phaneuf D, Julien J. Withania somnifera Reverses Transactive Response DNA Binding Protein 43 Proteinopathy in a Mouse Model of Amyotrophic Lateral Sclerosis/Frontotemporal Lobar Degeneration. Neurotherapeutics. 2017;14:447-462 pubmed publisher
Gelpi E, Hoftberger R, Graus F, Ling H, Holton J, Dawson T, et al. Neuropathological criteria of anti-IgLON5-related tauopathy. Acta Neuropathol. 2016;132:531-43 pubmed publisher
Wang W, Wang L, Lu J, Siedlak S, Fujioka H, Liang J, et al. The inhibition of TDP-43 mitochondrial localization blocks its neuronal toxicity. Nat Med. 2016;22:869-78 pubmed publisher
Ansoleaga B, Garcia Esparcia P, Llorens F, Hernández Ortega K, Carmona Tech M, Antonio Del Río J, et al. Altered Mitochondria, Protein Synthesis Machinery, and Purine Metabolism Are Molecular Contributors to the Pathogenesis of Creutzfeldt-Jakob Disease. J Neuropathol Exp Neurol. 2016;: pubmed
Koyama A, Sugai A, Kato T, Ishihara T, Shiga A, Toyoshima Y, et al. Increased cytoplasmic TARDBP mRNA in affected spinal motor neurons in ALS caused by abnormal autoregulation of TDP-43. Nucleic Acids Res. 2016;44:5820-36 pubmed publisher
Mashiko T, Sakashita E, Kasashima K, Tominaga K, Kuroiwa K, Nozaki Y, et al. Developmentally Regulated RNA-binding Protein 1 (Drb1)/RNA-binding Motif Protein 45 (RBM45), a Nuclear-Cytoplasmic Trafficking Protein, Forms TAR DNA-binding Protein 43 (TDP-43)-mediated Cytoplasmic Aggregates. J Biol Chem. 2016;291:14996-5007 pubmed publisher
De Marco G, Lomartire A, Calvo A, Risso A, De Luca E, Mostert M, et al. Monocytes of patients with amyotrophic lateral sclerosis linked to gene mutations display altered TDP-43 subcellular distribution. Neuropathol Appl Neurobiol. 2017;43:133-153 pubmed publisher
Williams K, Topp S, Yang S, Smith B, Fifita J, Warraich S, et al. CCNF mutations in amyotrophic lateral sclerosis and frontotemporal dementia. Nat Commun. 2016;7:11253 pubmed publisher
Jiang L, Zhao J, Yin X, He W, Yang H, Che M, et al. Two mutations G335D and Q343R within the amyloidogenic core region of TDP-43 influence its aggregation and inclusion formation. Sci Rep. 2016;6:23928 pubmed publisher
Solla P, Grau Rivera O, Gelpi E, Marrosu F, Marti M. Pisa syndrome in a patient with pathologically confirmed Parkinson's disease. Neuropathol Appl Neurobiol. 2016;42:654-658 pubmed publisher
Wang G, Yang H, Yan S, Wang C, Liu X, Zhao B, et al. Cytoplasmic mislocalization of RNA splicing factors and aberrant neuronal gene splicing in TDP-43 transgenic pig brain. Mol Neurodegener. 2015;10:42 pubmed publisher
Lynch D, Jaunmuktane Z, Sheerin U, Phadke R, Brandner S, Milonas I, et al. Hereditary leukoencephalopathy with axonal spheroids: a spectrum of phenotypes from CNS vasculitis to parkinsonism in an adult onset leukodystrophy series. J Neurol Neurosurg Psychiatry. 2016;87:512-9 pubmed publisher
Goossens J, Vanmechelen E, Trojanowski J, Lee V, Van Broeckhoven C, van der Zee J, et al. TDP-43 as a possible biomarker for frontotemporal lobar degeneration: a systematic review of existing antibodies. Acta Neuropathol Commun. 2015;3:15 pubmed publisher
Xiao S, Sanelli T, Chiang H, Sun Y, Chakrabartty A, Keith J, et al. Low molecular weight species of TDP-43 generated by abnormal splicing form inclusions in amyotrophic lateral sclerosis and result in motor neuron death. Acta Neuropathol. 2015;130:49-61 pubmed publisher
Rosenbohm A, Buckert D, Gerischer N, Walcher T, Kassubek J, Rottbauer W, et al. Early diagnosis of cardiac involvement in idiopathic inflammatory myopathy by cardiac magnetic resonance tomography. J Neurol. 2015;262:949-56 pubmed publisher
Saldi T, Ash P, Wilson G, Gonzales P, Garrido Lecca A, Roberts C, et al. TDP-1, the Caenorhabditis elegans ortholog of TDP-43, limits the accumulation of double-stranded RNA. EMBO J. 2014;33:2947-66 pubmed publisher
Alafuzoff I, Pikkarainen M, Neumann M, Arzberger T, Al Sarraj S, Bodi I, et al. Neuropathological assessments of the pathology in frontotemporal lobar degeneration with TDP43-positive inclusions: an inter-laboratory study by the BrainNet Europe consortium. J Neural Transm (Vienna). 2015;122:957-72 pubmed publisher
Yarchoan M, Toledo J, Lee E, Arvanitakis Z, Kazi H, Han L, et al. Abnormal serine phosphorylation of insulin receptor substrate 1 is associated with tau pathology in Alzheimer's disease and tauopathies. Acta Neuropathol. 2014;128:679-89 pubmed publisher
Kara E, Kiely A, Proukakis C, Giffin N, Love S, Hehir J, et al. A 6.4 Mb duplication of the ?-synuclein locus causing frontotemporal dementia and Parkinsonism: phenotype-genotype correlations. JAMA Neurol. 2014;71:1162-71 pubmed publisher
Robinson A, Thompson J, Weedon L, Rollinson S, Pickering Brown S, Snowden J, et al. No interaction between tau and TDP-43 pathologies in either frontotemporal lobar degeneration or motor neurone disease. Neuropathol Appl Neurobiol. 2014;40:844-54 pubmed publisher
Wenqiang C, Lonskaya I, Hebron M, Ibrahim Z, Olszewski R, Neale J, et al. Parkin-mediated reduction of nuclear and soluble TDP-43 reverses behavioral decline in symptomatic mice. Hum Mol Genet. 2014;23:4960-9 pubmed publisher
Hans F, Fiesel F, Strong J, J ckel S, Rasse T, Geisler S, et al. UBE2E ubiquitin-conjugating enzymes and ubiquitin isopeptidase Y regulate TDP-43 protein ubiquitination. J Biol Chem. 2014;289:19164-79 pubmed publisher
Ohta Y, Tremblay C, Schneider J, Bennett D, Calon F, Julien J. Interaction of transactive response DNA binding protein 43 with nuclear factor ?B in mild cognitive impairment with episodic memory deficits. Acta Neuropathol Commun. 2014;2:37 pubmed publisher
Carlomagno Y, Zhang Y, Davis M, Lin W, Cook C, Dunmore J, et al. Casein kinase II induced polymerization of soluble TDP-43 into filaments is inhibited by heat shock proteins. PLoS ONE. 2014;9:e90452 pubmed publisher
Araki W, Minegishi S, Motoki K, Kume H, Hohjoh H, Araki Y, et al. Disease-associated mutations of TDP-43 promote turnover of the protein through the proteasomal pathway. Mol Neurobiol. 2014;50:1049-58 pubmed publisher
Cortese A, Plagnol V, Brady S, Simone R, Lashley T, Acevedo Arozena A, et al. Widespread RNA metabolism impairment in sporadic inclusion body myositis TDP43-proteinopathy. Neurobiol Aging. 2014;35:1491-8 pubmed publisher
De Marco G, Lomartire A, Mandili G, Lupino E, Buccinnà B, Ramondetti C, et al. Reduced cellular Ca(2+) availability enhances TDP-43 cleavage by apoptotic caspases. Biochim Biophys Acta. 2014;1843:725-34 pubmed publisher
Gelpi E, Navarro Otano J, Tolosa E, Gaig C, Compta Y, Rey M, et al. Multiple organ involvement by alpha-synuclein pathology in Lewy body disorders. Mov Disord. 2014;29:1010-8 pubmed publisher
Yan S, Wang C, Wei W, Gaertig M, Lai L, Li S, et al. TDP-43 causes differential pathology in neuronal versus glial cells in the mouse brain. Hum Mol Genet. 2014;23:2678-93 pubmed publisher
Balasa M, Gelpi E, Rey M, Vila J, Ramió Torrentà L, Quiles Granado A, et al. Clinical and neuropathological variability in clinically isolated central nervous system Whipple's disease. Brain Pathol. 2014;24:230-8 pubmed publisher
Walker A, Soo K, Sundaramoorthy V, Parakh S, Ma Y, Farg M, et al. ALS-associated TDP-43 induces endoplasmic reticulum stress, which drives cytoplasmic TDP-43 accumulation and stress granule formation. PLoS ONE. 2013;8:e81170 pubmed publisher
Suarez Calvet M, Dols Icardo O, Lladó A, Sanchez Valle R, Hernandez I, Amer G, et al. Plasma phosphorylated TDP-43 levels are elevated in patients with frontotemporal dementia carrying a C9orf72 repeat expansion or a GRN mutation. J Neurol Neurosurg Psychiatry. 2014;85:684-91 pubmed publisher
Hebron M, Chen W, Miessau M, Lonskaya I, Moussa C. Parkin reverses TDP-43-induced cell death and failure of amino acid homeostasis. J Neurochem. 2014;129:350-61 pubmed publisher
Iovino M, Pfisterer U, Holton J, Lashley T, Swingler R, Calò L, et al. The novel MAPT mutation K298E: mechanisms of mutant tau toxicity, brain pathology and tau expression in induced fibroblast-derived neurons. Acta Neuropathol. 2014;127:283-95 pubmed publisher
Lashley T, Rohrer J, Mahoney C, Gordon E, Beck J, Mead S, et al. A pathogenic progranulin mutation and C9orf72 repeat expansion in a family with frontotemporal dementia. Neuropathol Appl Neurobiol. 2014;40:502-13 pubmed publisher
Grau Rivera O, Gelpi E, Rey M, Valldeoriola F, Tolosa E, Compta Y, et al. Prominent psychiatric symptoms in patients with Parkinson's disease and concomitant argyrophilic grain disease. J Neurol. 2013;260:3002-9 pubmed publisher
Medina D, Orr M, Oddo S. Accumulation of C-terminal fragments of transactive response DNA-binding protein 43 leads to synaptic loss and cognitive deficits in human TDP-43 transgenic mice. Neurobiol Aging. 2014;35:79-87 pubmed publisher
Xu Y, Prudencio M, Hubbard J, Tong J, Whitelaw E, Jansen West K, et al. The pathological phenotypes of human TDP-43 transgenic mouse models are independent of downregulation of mouse Tdp-43. PLoS ONE. 2013;8:e69864 pubmed publisher
Prell T, Grosskreutz J. The involvement of the cerebellum in amyotrophic lateral sclerosis. Amyotroph Lateral Scler Frontotemporal Degener. 2013;14:507-15 pubmed publisher
Finsterer J, Stollberger C, Kovacs G. Asymptomatic hyper-creatine-kinase-emia as sole manifestation of inclusion body myositis. Neurol Int. 2013;5:34-6 pubmed publisher
Nishimoto Y, Nakagawa S, Hirose T, Okano H, Takao M, Shibata S, et al. The long non-coding RNA nuclear-enriched abundant transcript 1_2 induces paraspeckle formation in the motor neuron during the early phase of amyotrophic lateral sclerosis. Mol Brain. 2013;6:31 pubmed publisher
Mundiñano I, Hernandez M, Dicaudo C, Ordóñez C, Marcilla I, Tuñon M, et al. Reduced cholinergic olfactory centrifugal inputs in patients with neurodegenerative disorders and MPTP-treated monkeys. Acta Neuropathol. 2013;126:411-25 pubmed publisher
Tong J, Huang C, Bi F, Wu Q, Huang B, Liu X, et al. Expression of ALS-linked TDP-43 mutant in astrocytes causes non-cell-autonomous motor neuron death in rats. EMBO J. 2013;32:1917-26 pubmed publisher
Gelpi E, Cullel F, Navarro Otano J, Lladó A. Globular glial-like inclusions in a patient with advanced Alzheimer's disease. Acta Neuropathol. 2013;126:155-7 pubmed publisher
Dayton R, Gitcho M, Orchard E, Wilson J, Wang D, Cain C, et al. Selective forelimb impairment in rats expressing a pathological TDP-43 25?kDa C-terminal fragment to mimic amyotrophic lateral sclerosis. Mol Ther. 2013;21:1324-34 pubmed publisher
Iyer A, Prabowo A, Anink J, Spliet W, Van Rijen P, Aronica E. Cell injury and premature neurodegeneration in focal malformations of cortical development. Brain Pathol. 2014;24:1-17 pubmed publisher
Iranzo A, Tolosa E, Gelpi E, Molinuevo J, Valldeoriola F, Serradell M, et al. Neurodegenerative disease status and post-mortem pathology in idiopathic rapid-eye-movement sleep behaviour disorder: an observational cohort study. Lancet Neurol. 2013;12:443-53 pubmed publisher
Bi F, Huang C, Tong J, Qiu G, Huang B, Wu Q, et al. Reactive astrocytes secrete lcn2 to promote neuron death. Proc Natl Acad Sci U S A. 2013;110:4069-74 pubmed publisher
Doherty K, Rohrer J, Lees A, Holton J, Warren J. Primary progressive aphasia with parkinsonism. Mov Disord. 2013;28:741-6 pubmed publisher
Hebron M, Lonskaya I, Sharpe K, Weerasinghe P, Algarzae N, Shekoyan A, et al. Parkin ubiquitinates Tar-DNA binding protein-43 (TDP-43) and promotes its cytosolic accumulation via interaction with histone deacetylase 6 (HDAC6). J Biol Chem. 2013;288:4103-15 pubmed publisher
Swarup V, Audet J, Phaneuf D, Kriz J, Julien J. Abnormal regenerative responses and impaired axonal outgrowth after nerve crush in TDP-43 transgenic mouse models of amyotrophic lateral sclerosis. J Neurosci. 2012;32:18186-95 pubmed publisher
Watanabe S, Kaneko K, Yamanaka K. Accelerated disease onset with stabilized familial amyotrophic lateral sclerosis (ALS)-linked mutant TDP-43 proteins. J Biol Chem. 2013;288:3641-54 pubmed publisher
Tong J, Huang C, Bi F, Wu Q, Huang B, Zhou H. XBP1 depletion precedes ubiquitin aggregation and Golgi fragmentation in TDP-43 transgenic rats. J Neurochem. 2012;123:406-16 pubmed publisher
Lopez Gonzalez I, Carmona M, Blanco R, Luna Munoz J, Martínez Mandonado A, Mena R, et al. Characterization of thorn-shaped astrocytes in white matter of temporal lobe in Alzheimer's disease brains. Brain Pathol. 2013;23:144-53 pubmed publisher
Verstraete E, Kuiperij H, van Blitterswijk M, Veldink J, Schelhaas H, van den Berg L, et al. TDP-43 plasma levels are higher in amyotrophic lateral sclerosis. Amyotroph Lateral Scler. 2012;13:446-51 pubmed publisher
Gelpi E, Soler Insa J, Parchi P, Saverioni D, Yague J, Nos C, et al. Atypical neuropathological sCJD-MM phenotype with abundant white matter Kuru-type plaques sparing the cerebellar cortex. Neuropathology. 2013;33:204-8 pubmed publisher
Colom Cadena M, Gelpi E, Marti M, Charif S, Dols Icardo O, Blesa R, et al. MAPT H1 haplotype is associated with enhanced ?-synuclein deposition in dementia with Lewy bodies. Neurobiol Aging. 2013;34:936-42 pubmed publisher
Vilas D, Marti M, Botta Orfila T, Colom Cadena M, Gelpi E. Pick's pathology in Parkinson's disease with dementia. Neuropathol Appl Neurobiol. 2012;38:737-43 pubmed publisher
Echávarri C, Burgmans S, Caballero M, Garcia Bragado F, Verhey F, Uylings H. Co-occurrence of different pathologies in dementia: implications for dementia diagnosis. J Alzheimers Dis. 2012;30:909-17 pubmed publisher
Herman A, Khandelwal P, Rebeck G, Moussa C. Wild type TDP-43 induces neuro-inflammation and alters APP metabolism in lentiviral gene transfer models. Exp Neurol. 2012;235:297-305 pubmed publisher
Troakes C, Maekawa S, Wijesekera L, Rogelj B, Siklós L, Bell C, et al. An MND/ALS phenotype associated with C9orf72 repeat expansion: abundant p62-positive, TDP-43-negative inclusions in cerebral cortex, hippocampus and cerebellum but without associated cognitive decline. Neuropathology. 2012;32:505-14 pubmed publisher
Dayton R, Wang D, Cain C, Schrott L, Ramirez J, King M, et al. Frontotemporal lobar degeneration-related proteins induce only subtle memory-related deficits when bilaterally overexpressed in the dorsal hippocampus. Exp Neurol. 2012;233:807-14 pubmed publisher
Huang C, Tong J, Bi F, Zhou H, Xia X. Mutant TDP-43 in motor neurons promotes the onset and progression of ALS in rats. J Clin Invest. 2012;122:107-18 pubmed publisher
Pirici D, Pirici I, Mogoanta L, Mărgăritescu O, Tudorică V, Margaritescu C, et al. Matrix metalloproteinase-9 expression in the nuclear compartment of neurons and glial cells in aging and stroke. Neuropathology. 2012;32:492-504 pubmed publisher
Tsuji H, Nonaka T, Yamashita M, Masuda Suzukake M, Kametani F, Akiyama H, et al. Epitope mapping of antibodies against TDP-43 and detection of protease-resistant fragments of pathological TDP-43 in amyotrophic lateral sclerosis and frontotemporal lobar degeneration. Biochem Biophys Res Commun. 2012;417:116-21 pubmed publisher
Fiesel F, Weber S, Supper J, Zell A, Kahle P. TDP-43 regulates global translational yield by splicing of exon junction complex component SKAR. Nucleic Acids Res. 2012;40:2668-82 pubmed publisher
Antonell A, Gelpi E, Sanchez Valle R, Martinez R, Molinuevo J, Lladó A. Breakpoint sequence analysis of an A?PP locus duplication associated with autosomal dominant Alzheimer's disease and severe cerebral amyloid angiopathy. J Alzheimers Dis. 2012;28:303-8 pubmed publisher
Thom M, Liu J, Thompson P, Phadke R, Narkiewicz M, Martinian L, et al. Neurofibrillary tangle pathology and Braak staging in chronic epilepsy in relation to traumatic brain injury and hippocampal sclerosis: a post-mortem study. Brain. 2011;134:2969-81 pubmed publisher
Wang J, Brent J, Tomlinson A, Shneider N, McCabe B. The ALS-associated proteins FUS and TDP-43 function together to affect Drosophila locomotion and life span. J Clin Invest. 2011;121:4118-26 pubmed publisher
Swarup V, Phaneuf D, Bareil C, Robertson J, Rouleau G, Kriz J, et al. Pathological hallmarks of amyotrophic lateral sclerosis/frontotemporal lobar degeneration in transgenic mice produced with TDP-43 genomic fragments. Brain. 2011;134:2610-26 pubmed publisher
Martínez Sáez E, Gelpi E, Rey M, Ferrer I, Ribalta T, Botta Orfila T, et al. Hirano body-rich subtypes of Creutzfeldt-Jakob disease. Neuropathol Appl Neurobiol. 2012;38:153-61 pubmed publisher
Azizi A, Li L, Strobel T, Chen W, Slavc I, Lubec G. Identification of c-myc-dependent proteins in the medulloblastoma cell line D425Med. Amino Acids. 2012;42:2149-63 pubmed publisher
López Hernández T, Sirisi S, Capdevila Nortes X, Montolio M, Fernández Dueñas V, Scheper G, et al. Molecular mechanisms of MLC1 and GLIALCAM mutations in megalencephalic leukoencephalopathy with subcortical cysts. Hum Mol Genet. 2011;20:3266-77 pubmed publisher
Rusina R, Kovacs G, Fiala J, Hort J, Ridzon P, Holmerová I, et al. FTLD-TDP with motor neuron disease, visuospatial impairment and a progressive supranuclear palsy-like syndrome: broadening the clinical phenotype of TDP-43 proteinopathies. A report of three cases. BMC Neurol. 2011;11:50 pubmed publisher
Mundiñano I, Caballero M, Ordóñez C, Hernandez M, Dicaudo C, Marcilla I, et al. Increased dopaminergic cells and protein aggregates in the olfactory bulb of patients with neurodegenerative disorders. Acta Neuropathol. 2011;122:61-74 pubmed publisher
Pikkarainen M, Hartikainen P, Soininen H, Alafuzoff I. Distribution and pattern of pathology in subjects with familial or sporadic late-onset cerebellar ataxia as assessed by p62/sequestosome immunohistochemistry. Cerebellum. 2011;10:720-31 pubmed publisher
Hartikainen P, Pikkarainen M, Hanninen T, Soininen H, Alafuzoff I. Unusual clinical presentation and neuropathology in two subjects with fused-in sarcoma (FUS) positive inclusions. Neuropathology. 2012;32:60-8 pubmed publisher
Che M, Jiang Y, Xie Y, Jiang L, Hu H. Aggregation of the 35-kDa fragment of TDP-43 causes formation of cytoplasmic inclusions and alteration of RNA processing. FASEB J. 2011;25:2344-53 pubmed publisher
Tian T, Huang C, Tong J, Yang M, Zhou H, Xia X. TDP-43 potentiates alpha-synuclein toxicity to dopaminergic neurons in transgenic mice. Int J Biol Sci. 2011;7:234-43 pubmed
Herman A, Khandelwal P, Stanczyk B, Rebeck G, Moussa C. ?-amyloid triggers ALS-associated TDP-43 pathology in AD models. Brain Res. 2011;1386:191-9 pubmed publisher
Lashley T, Holton J, Revesz T. TDP-43 pathology may occur in the BRI2 gene-related dementias. Acta Neuropathol. 2011;121:559-60 pubmed publisher
Rauramaa T, Pikkarainen M, Englund E, Ince P, Jellinger K, Paetau A, et al. TAR-DNA binding protein-43 and alterations in the hippocampus. J Neural Transm (Vienna). 2011;118:683-9 pubmed publisher
Noto Y, Shibuya K, Sato Y, Kanai K, Misawa S, Sawai S, et al. Elevated CSF TDP-43 levels in amyotrophic lateral sclerosis: specificity, sensitivity, and a possible prognostic value. Amyotroph Lateral Scler. 2011;12:140-3 pubmed publisher
De Marco G, Lupino E, Calvo A, Moglia C, Buccinnà B, Grifoni S, et al. Cytoplasmic accumulation of TDP-43 in circulating lymphomonocytes of ALS patients with and without TARDBP mutations. Acta Neuropathol. 2011;121:611-22 pubmed publisher
Higashi S, Tsuchiya Y, Araki T, Wada K, Kabuta T. TDP-43 physically interacts with amyotrophic lateral sclerosis-linked mutant CuZn superoxide dismutase. Neurochem Int. 2010;57:906-13 pubmed publisher
Wang D, Dayton R, Henning P, Cain C, Zhao L, Schrott L, et al. Expansive gene transfer in the rat CNS rapidly produces amyotrophic lateral sclerosis relevant sequelae when TDP-43 is overexpressed. Mol Ther. 2010;18:2064-74 pubmed publisher
Hoftberger R, Fink S, Aboul Enein F, Botond G, Olah J, Berki T, et al. Tubulin polymerization promoting protein (TPPP/p25) as a marker for oligodendroglial changes in multiple sclerosis. Glia. 2010;58:1847-57 pubmed publisher
Shan X, Chiang P, Price D, Wong P. Altered distributions of Gemini of coiled bodies and mitochondria in motor neurons of TDP-43 transgenic mice. Proc Natl Acad Sci U S A. 2010;107:16325-30 pubmed publisher
Xu Y, Gendron T, Zhang Y, Lin W, D Alton S, Sheng H, et al. Wild-type human TDP-43 expression causes TDP-43 phosphorylation, mitochondrial aggregation, motor deficits, and early mortality in transgenic mice. J Neurosci. 2010;30:10851-9 pubmed publisher
Ling S, Albuquerque C, Han J, Lagier Tourenne C, Tokunaga S, Zhou H, et al. ALS-associated mutations in TDP-43 increase its stability and promote TDP-43 complexes with FUS/TLS. Proc Natl Acad Sci U S A. 2010;107:13318-23 pubmed publisher
Saito T, Hanai S, Takashima S, Nakagawa E, Okazaki S, Inoue T, et al. Neocortical layer formation of human developing brains and lissencephalies: consideration of layer-specific marker expression. Cereb Cortex. 2011;21:588-96 pubmed publisher
Jansen C, Head M, van Gool W, Baas F, Yull H, Ironside J, et al. The first case of protease-sensitive prionopathy (PSPr) in The Netherlands: a patient with an unusual GSS-like clinical phenotype. J Neurol Neurosurg Psychiatry. 2010;81:1052-5 pubmed publisher
Ash P, Zhang Y, Roberts C, Saldi T, Hutter H, Buratti E, et al. Neurotoxic effects of TDP-43 overexpression in C. elegans. Hum Mol Genet. 2010;19:3206-18 pubmed publisher
Maruyama H, Morino H, Ito H, Izumi Y, Kato H, Watanabe Y, et al. Mutations of optineurin in amyotrophic lateral sclerosis. Nature. 2010;465:223-6 pubmed publisher
Braak H, Ludolph A, Thal D, Del Tredici K. Amyotrophic lateral sclerosis: dash-like accumulation of phosphorylated TDP-43 in somatodendritic and axonal compartments of somatomotor neurons of the lower brainstem and spinal cord. Acta Neuropathol. 2010;120:67-74 pubmed publisher
Ilieva E, Naudi A, Kichev A, Ferrer I, Pamplona R, Portero Otin M. Depletion of oxidative and endoplasmic reticulum stress regulators in Pick disease. Free Radic Biol Med. 2010;48:1302-10 pubmed publisher
Wils H, Kleinberger G, Janssens J, Pereson S, Joris G, Cuijt I, et al. TDP-43 transgenic mice develop spastic paralysis and neuronal inclusions characteristic of ALS and frontotemporal lobar degeneration. Proc Natl Acad Sci U S A. 2010;107:3858-63 pubmed publisher
Zhang H, Tanji K, Yoshida H, Hayakari M, Shibata T, Mori F, et al. Alteration of biochemical and pathological properties of TDP-43 protein by a lipid mediator, 15-deoxy-Delta(12,14)-prostaglandin J(2). Exp Neurol. 2010;222:296-303 pubmed publisher
Fiesel F, Voigt A, Weber S, Van den Haute C, Waldenmaier A, Görner K, et al. Knockdown of transactive response DNA-binding protein (TDP-43) downregulates histone deacetylase 6. EMBO J. 2010;29:209-21 pubmed publisher
Nishimoto Y, Ito D, Yagi T, Nihei Y, Tsunoda Y, Suzuki N. Characterization of alternative isoforms and inclusion body of the TAR DNA-binding protein-43. J Biol Chem. 2010;285:608-19 pubmed publisher
Foulds P, Davidson Y, Mishra M, Hobson D, Humphreys K, Taylor M, et al. Plasma phosphorylated-TDP-43 protein levels correlate with brain pathology in frontotemporal lobar degeneration. Acta Neuropathol. 2009;118:647-58 pubmed publisher
Velakoulis D, Walterfang M, Mocellin R, Pantelis C, Dean B, McLean C. Abnormal hippocampal distribution of TDP-43 in patients with-late onset psychosis. Aust N Z J Psychiatry. 2009;43:739-45 pubmed publisher
Moisse K, Mepham J, Volkening K, Welch I, Hill T, Strong M. Cytosolic TDP-43 expression following axotomy is associated with caspase 3 activation in NFL-/- mice: support for a role for TDP-43 in the physiological response to neuronal injury. Brain Res. 2009;1296:176-86 pubmed publisher
Velakoulis D, Walterfang M, Mocellin R, Pantelis C, McLean C. Frontotemporal dementia presenting as schizophrenia-like psychosis in young people: clinicopathological series and review of cases. Br J Psychiatry. 2009;194:298-305 pubmed publisher
Humayun S, Gohar M, Volkening K, Moisse K, Leystra Lantz C, Mepham J, et al. The complement factor C5a receptor is upregulated in NFL-/- mouse motor neurons. J Neuroimmunol. 2009;210:52-62 pubmed publisher
Gitcho M, Strider J, Carter D, Taylor Reinwald L, Forman M, Goate A, et al. VCP mutations causing frontotemporal lobar degeneration disrupt localization of TDP-43 and induce cell death. J Biol Chem. 2009;284:12384-98 pubmed publisher
Olive M, Janué A, Moreno D, Gamez J, Torrejón Escribano B, Ferrer I. TAR DNA-Binding protein 43 accumulation in protein aggregate myopathies. J Neuropathol Exp Neurol. 2009;68:262-73 pubmed publisher
Rollinson S, Rizzu P, Sikkink S, Baker M, Halliwell N, Snowden J, et al. Ubiquitin associated protein 1 is a risk factor for frontotemporal lobar degeneration. Neurobiol Aging. 2009;30:656-65 pubmed publisher
Igaz L, Kwong L, Chen Plotkin A, Winton M, Unger T, Xu Y, et al. Expression of TDP-43 C-terminal Fragments in Vitro Recapitulates Pathological Features of TDP-43 Proteinopathies. J Biol Chem. 2009;284:8516-24 pubmed publisher
Clarimon J, Molina Porcel L, Gomez Isla T, Blesa R, Guardia Laguarta C, Gonzalez Neira A, et al. Early-onset familial lewy body dementia with extensive tauopathy: a clinical, genetic, and neuropathological study. J Neuropathol Exp Neurol. 2009;68:73-82 pubmed publisher
Moisse K, Volkening K, Leystra Lantz C, Welch I, Hill T, Strong M. Divergent patterns of cytosolic TDP-43 and neuronal progranulin expression following axotomy: implications for TDP-43 in the physiological response to neuronal injury. Brain Res. 2009;1249:202-11 pubmed publisher
Schwab C, Arai T, Hasegawa M, Yu S, McGeer P. Colocalization of transactivation-responsive DNA-binding protein 43 and huntingtin in inclusions of Huntington disease. J Neuropathol Exp Neurol. 2008;67:1159-65 pubmed publisher
Steinacker P, Hendrich C, Sperfeld A, Jesse S, von Arnim C, Lehnert S, et al. TDP-43 in cerebrospinal fluid of patients with frontotemporal lobar degeneration and amyotrophic lateral sclerosis. Arch Neurol. 2008;65:1481-7 pubmed publisher
Seppänen A, Pikkarainen M, Hartikainen P, Hofmann S, Majamaa K, Alafuzoff I. Expression of collagen XVII and ubiquitin-binding protein p62 in motor neuron disease. Brain Res. 2009;1247:171-7 pubmed publisher
Kasai T, Tokuda T, Ishigami N, Sasayama H, Foulds P, Mitchell D, et al. Increased TDP-43 protein in cerebrospinal fluid of patients with amyotrophic lateral sclerosis. Acta Neuropathol. 2009;117:55-62 pubmed publisher
Nishihira Y, Tan C, Hoshi Y, Iwanaga K, Yamada M, Kawachi I, et al. Sporadic amyotrophic lateral sclerosis of long duration is associated with relatively mild TDP-43 pathology. Acta Neuropathol. 2009;117:45-53 pubmed publisher
Skoglund L, Brundin R, Olofsson T, Kalimo H, Ingvast S, Blom E, et al. Frontotemporal dementia in a large Swedish family is caused by a progranulin null mutation. Neurogenetics. 2009;10:27-34 pubmed publisher
Miklossy J, Steele J, Yu S, McCall S, Sandberg G, McGeer E, et al. Enduring involvement of tau, beta-amyloid, alpha-synuclein, ubiquitin and TDP-43 pathology in the amyotrophic lateral sclerosis/parkinsonism-dementia complex of Guam (ALS/PDC). Acta Neuropathol. 2008;116:625-37 pubmed publisher
Kovacs G, Majtenyi K, Spina S, Murrell J, Gelpi E, Hoftberger R, et al. White matter tauopathy with globular glial inclusions: a distinct sporadic frontotemporal lobar degeneration. J Neuropathol Exp Neurol. 2008;67:963-75 pubmed publisher
Weihl C, Temiz P, Miller S, Watts G, Smith C, Forman M, et al. TDP-43 accumulation in inclusion body myopathy muscle suggests a common pathogenic mechanism with frontotemporal dementia. J Neurol Neurosurg Psychiatry. 2008;79:1186-9 pubmed publisher
Lin W, Dickson D. Ultrastructural localization of TDP-43 in filamentous neuronal inclusions in various neurodegenerative diseases. Acta Neuropathol. 2008;116:205-13 pubmed publisher
Mori F, Tanji K, Zhang H, Nishihira Y, Tan C, Takahashi H, et al. Maturation process of TDP-43-positive neuronal cytoplasmic inclusions in amyotrophic lateral sclerosis with and without dementia. Acta Neuropathol. 2008;116:193-203 pubmed publisher
Sleegers K, Kumar Singh S, Cruts M, Van Broeckhoven C. Molecular pathogenesis of frontotemporal lobar degeneration: basic science seminar in neurology. Arch Neurol. 2008;65:700-4 pubmed publisher
Igaz L, Kwong L, Xu Y, Truax A, Uryu K, Neumann M, et al. Enrichment of C-terminal fragments in TAR DNA-binding protein-43 cytoplasmic inclusions in brain but not in spinal cord of frontotemporal lobar degeneration and amyotrophic lateral sclerosis. Am J Pathol. 2008;173:182-94 pubmed publisher
Foulds P, McAuley E, Gibbons L, Davidson Y, Pickering Brown S, Neary D, et al. TDP-43 protein in plasma may index TDP-43 brain pathology in Alzheimer's disease and frontotemporal lobar degeneration. Acta Neuropathol. 2008;116:141-6 pubmed publisher
Johnson B, McCaffery J, Lindquist S, Gitler A. A yeast TDP-43 proteinopathy model: Exploring the molecular determinants of TDP-43 aggregation and cellular toxicity. Proc Natl Acad Sci U S A. 2008;105:6439-44 pubmed publisher
Winton M, Igaz L, Wong M, Kwong L, Trojanowski J, Lee V. Disturbance of nuclear and cytoplasmic TAR DNA-binding protein (TDP-43) induces disease-like redistribution, sequestration, and aggregate formation. J Biol Chem. 2008;283:13302-9 pubmed publisher
Zhang H, Tanji K, Mori F, Wakabayashi K. Epitope mapping of 2E2-D3, a monoclonal antibody directed against human TDP-43. Neurosci Lett. 2008;434:170-4 pubmed publisher
Beck J, Rohrer J, Campbell T, Isaacs A, Morrison K, Goodall E, et al. A distinct clinical, neuropsychological and radiological phenotype is associated with progranulin gene mutations in a large UK series. Brain. 2008;131:706-20 pubmed publisher
Sanelli T, Xiao S, Horne P, Bilbao J, Zinman L, Robertson J. Evidence that TDP-43 is not the major ubiquitinated target within the pathological inclusions of amyotrophic lateral sclerosis. J Neuropathol Exp Neurol. 2007;66:1147-53 pubmed
Kovacs G, Pittman A, Revesz T, Luk C, Lees A, Kiss E, et al. MAPT S305I mutation: implications for argyrophilic grain disease. Acta Neuropathol. 2008;116:103-18 pubmed
Shankaran S, Capell A, Hruscha A, Fellerer K, Neumann M, Schmid B, et al. Missense mutations in the progranulin gene linked to frontotemporal lobar degeneration with ubiquitin-immunoreactive inclusions reduce progranulin production and secretion. J Biol Chem. 2008;283:1744-53 pubmed
Zhang H, Tan C, Mori F, Tanji K, Kakita A, Takahashi H, et al. TDP-43-immunoreactive neuronal and glial inclusions in the neostriatum in amyotrophic lateral sclerosis with and without dementia. Acta Neuropathol. 2008;115:115-22 pubmed
Amador Ortiz C, Lin W, Ahmed Z, Personett D, Davies P, Duara R, et al. TDP-43 immunoreactivity in hippocampal sclerosis and Alzheimer's disease. Ann Neurol. 2007;61:435-45 pubmed
Mackenzie I, Bigio E, Ince P, Geser F, Neumann M, Cairns N, et al. Pathological TDP-43 distinguishes sporadic amyotrophic lateral sclerosis from amyotrophic lateral sclerosis with SOD1 mutations. Ann Neurol. 2007;61:427-34 pubmed
Hasegawa M, Arai T, Akiyama H, Nonaka T, Mori H, Hashimoto T, et al. TDP-43 is deposited in the Guam parkinsonism-dementia complex brains. Brain. 2007;130:1386-94 pubmed
Neumann M, Kwong L, Truax A, Vanmassenhove B, Kretzschmar H, Van Deerlin V, et al. TDP-43-positive white matter pathology in frontotemporal lobar degeneration with ubiquitin-positive inclusions. J Neuropathol Exp Neurol. 2007;66:177-83 pubmed
Tan C, Eguchi H, Tagawa A, Onodera O, Iwasaki T, Tsujino A, et al. TDP-43 immunoreactivity in neuronal inclusions in familial amyotrophic lateral sclerosis with or without SOD1 gene mutation. Acta Neuropathol. 2007;113:535-42 pubmed
Neumann M, Mackenzie I, Cairns N, Boyer P, Markesbery W, Smith C, et al. TDP-43 in the ubiquitin pathology of frontotemporal dementia with VCP gene mutations. J Neuropathol Exp Neurol. 2007;66:152-7 pubmed
Arai T, Hasegawa M, Akiyama H, Ikeda K, Nonaka T, Mori H, et al. TDP-43 is a component of ubiquitin-positive tau-negative inclusions in frontotemporal lobar degeneration and amyotrophic lateral sclerosis. Biochem Biophys Res Commun. 2006;351:602-11 pubmed
product information
brand :
Novus
catalog number base :
H00023435-M01
SKU :
H00023435-M01
product name :
TDP-43/TARDBP Antibody (2E2-D3) - Azide and BSA Free
units size :
0.1 mg
description :
The TDP-43/TARDBP Antibody (2E2-D3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to TDP-43/TARDBP. This antibody reacts with bacteria,firefly,human,insect,monkey,mouse,rat. The TDP-43/TARDBP Antibody (2E2-D3) - Azide and BSA Free has been validated for the following applications: IF/IHC,ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Functional,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.
target :
TDP-43/TARDBP
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
2E2-D3
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Mouse
immunogen :
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGAC
GLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYP
KDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTE
QDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE
TQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFV
GRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTF
ADDQIAQSLCGEDLIIKGISVHISNA
TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
IgG purified
species :
Bacteria,Firefly,Human,Insect,Monkey,Mouse,Rat
specificity :
Specific for the ~ 43kDa TDP-43 protein in Western blots of rat brain lysate
theoretical molecular weight :
45 kDa
gene symbol :
TARDBP
review stars :
5
Antibody validation :
Knockout/Knockdown
top caption :
Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01]
accessionNumbers :
Q13148
applications :
IF/IHC,ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Functional,Knockdown Validated,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
ALS10TAR DNA-binding protein-43, TAR DNA binding protein, TDP43, TDP-43, TDP-43TAR DNA-binding protein 43
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.