TRIM32 Antibody (2E5) | Novus Biologicals H00022954-M09 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

TRIM32 Antibody (2E5)

catalog :

H00022954-M09

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2.00E+05

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry

more info or order :

Novus Biologicals product webpage

citations: 10

Reference
Liu J, Lu S, Zheng L, Guo Q, Cao L, Xiao Y, et al. ATM-CHK2-TRIM32 axis regulates ATG7 ubiquitination to initiate autophagy under oxidative stress. Cell Rep. 2023;42:113402 pubmed publisher
Nicklas S, Hillje A, Okawa S, Rudolph I, Collmann F, van Wuellen T, et al. A complex of the ubiquitin ligase TRIM32 and the deubiquitinase USP7 balances the level of c-Myc ubiquitination and thereby determines neural stem cell fate specification. Cell Death Differ. 2019;26:728-740 pubmed publisher
Assereto S, Piccirillo R, Baratto S, Scudieri P, Fiorillo C, Massacesi M, et al. The ubiquitin ligase tripartite-motif-protein 32 is induced in Duchenne muscular dystrophy. Lab Invest. 2016;96:862-71 pubmed publisher
Bahnassawy L, Perumal T, González Cano L, Hillje A, Taher L, Makalowski W, et al. TRIM32 modulates pluripotency entry and exit by directly regulating Oct4 stability. Sci Rep. 2015;5:13456 pubmed publisher
Lee E, Kim W, Kim Y, Lee H, Kim H, Sun W. Polarized and Stage-Dependent Distribution of Immunoreactivity for Novel PDZ-Binding Protein Preso1 in Adult Neurogenic Regions. Endocrinol Metab (Seoul). 2014;29:349-55 pubmed publisher
Izumi H, Kaneko Y. Trim32 facilitates degradation of MYCN on spindle poles and induces asymmetric cell division in human neuroblastoma cells. Cancer Res. 2014;74:5620-30 pubmed publisher
Nicklas S, Otto A, Wu X, Miller P, Stelzer S, Wen Y, et al. TRIM32 regulates skeletal muscle stem cell differentiation and is necessary for normal adult muscle regeneration. PLoS ONE. 2012;7:e30445 pubmed publisher
Zhang Y, Liu J, Yao S, Li F, Xin L, Lai M, et al. Nuclear factor kappa B signaling initiates early differentiation of neural stem cells. Stem Cells. 2012;30:510-24 pubmed publisher
Sato T, Okumura F, Kano S, Kondo T, Ariga T, Hatakeyama S. TRIM32 promotes neural differentiation through retinoic acid receptor-mediated transcription. J Cell Sci. 2011;124:3492-502 pubmed publisher
Schwamborn J, Berezikov E, Knoblich J. The TRIM-NHL protein TRIM32 activates microRNAs and prevents self-renewal in mouse neural progenitors. Cell. 2009;136:913-25 pubmed publisher

product information

brand :

Novus

master code :

H00022954-M09

SKU :

H00022954-M09

product name :

TRIM32 Antibody (2E5)

unit size :

0.1 mg

seo description :

The TRIM32 Antibody (2E5) - Azide and BSA Free from Novus is a mouse monoclonal antibody to TRIM32. This antibody reacts with human,mouse. The TRIM32 Antibody (2E5) - Azide and BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Western Blot,Knockdown Validated.

target :

TRIM32

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2.00E+05

conjugate :

Unconjugated

dilution :

Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

host :

Mouse

immunogen :

RRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAE
ERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYK
AVLQEYGHEERRVQDELARSRK
TRIM32 (NP_036342, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

TRIM32 (2E5)

gene symbol :

TRIM32

accessionNumbers :

NP_036342

applications :

ELISA,Immunohistochemistry,Western Blot,Knockdown Validated,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

72 kDa Tat-interacting protein, BBS1172-KD, EC 6.3.2.-, HT2Alimb girdle muscular dystrophy 2H (autosomal recessive), LGMD2H, tripartite motif containing 32, Zinc finger protein HT2A, zinc-finger protein HT2A

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage