Dkk-1 Antibody (2A5) | Novus Biologicals H00022943-M11 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Dkk-1 Antibody (2A5)

catalog :

H00022943-M11

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2A5

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Kim J, Park S, Choi S, Kim S, Koh E, Won J, et al. Molecular subgrouping of medulloblastoma in pediatric population using the NanoString assay and comparison with immunohistochemistry methods. BMC Cancer. 2022;22:1221 pubmed publisher
Suda T, Yamashita T, Sunagozaka H, Okada H, Nio K, Sakai Y, et al. Dickkopf-1 Promotes Angiogenesis and is a Biomarker for Hepatic Stem Cell-like Hepatocellular Carcinoma. Int J Mol Sci. 2022;23: pubmed publisher
Robson J, Remke M, Kool M, Julian E, Korshunov A, Pfister S, et al. Identification of CD24 as a marker of Patched1 deleted medulloblastoma-initiating neural progenitor cells. PLoS ONE. 2019;14:e0210665 pubmed publisher
Shinojima N, Nakamura H, Tasaki M, Kameno K, Anai S, Iyama K, et al. A patient with medulloblastoma in its early developmental stage. J Neurosurg Pediatr. 2014;14:615-20 pubmed publisher
Yi N, Liao Q, Li Z, Xie B, Hu Y, Yi W, et al. RNA interference-mediated targeting of DKK1 gene expression in Ishikawa endometrial carcinoma cells causes increased tumor cell invasion and migration. Oncol Lett. 2013;6:756-762 pubmed
Min H, Lee J, Kim S, Park S. Genetic grouping of medulloblastomas by representative markers in pathologic diagnosis. Transl Oncol. 2013;6:265-72 pubmed
Shi R, Yang X, Shen Q, Yang L, Xu Y, Qiu S, et al. High expression of Dickkopf-related protein 1 is related to lymphatic metastasis and indicates poor prognosis in intrahepatic cholangiocarcinoma patients after surgery. Cancer. 2013;119:993-1003 pubmed publisher
Taylor M, Northcott P, Korshunov A, Remke M, Cho Y, Clifford S, et al. Molecular subgroups of medulloblastoma: the current consensus. Acta Neuropathol. 2012;123:465-72 pubmed publisher
Macdonald L, Sales K, Grant V, Brown P, Jabbour H, Catalano R. Prokineticin 1 induces Dickkopf 1 expression and regulates cell proliferation and decidualization in the human endometrium. Mol Hum Reprod. 2011;17:626-36 pubmed publisher
Shin H, Rho S, Jung D, Han I, Oh E, Kim J. Carbonic anhydrase IX (CA9) modulates tumor-associated cell migration and invasion. J Cell Sci. 2011;124:1077-87 pubmed publisher
D Amelio P, Roato I, D AMICO L, Veneziano L, Suman E, Sassi F, et al. Bone and bone marrow pro-osteoclastogenic cytokines are up-regulated in osteoporosis fragility fractures. Osteoporos Int. 2011;22:2869-77 pubmed publisher

product information

brand :

Novus

master code :

H00022943-M11

SKU :

H00022943-M11

product name :

Dkk-1 Antibody (2A5)

unit size :

0.1 mg

seo description :

The Dkk-1 Antibody (2A5) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Dkk-1. This antibody reacts with human,yeast. The Dkk-1 Antibody (2A5) - Azide and BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Microarray.

target :

Dkk-1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2A5

conjugate :

Unconjugated

dilution :

Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Microarray

host :

Mouse

immunogen :

MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNSVLNS
NAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTID
NYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKR
RKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITE
SFGNDHSTLDGYSRRTTLSSKMYHTTGQEGSVCLRSSDC
ASGLCCARHFWSKICKPVLKGGQVCTKHRRKGSHGLEIF
QRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
DKK1 (AAH01539.1, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2b Kappa

purity :

IgG purified

species :

Human,Yeast

specificity :

DKK1 - dickkopf homolog 1 (Xenopus laevis)

gene symbol :

DKK1

accessionNumbers :

AAH01539

applications :

ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Microarray,Western Blot,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

dickkopf (Xenopus laevis) homolog 1, dickkopf homolog 1 (Xenopus laevis), dickkopf related protein-1, Dickkopf-1, dickkopf-related protein 1, DKK-1, hDkk-1, SKdickkopf-1 like

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage