product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
AKAP13 Antibody (5B7)
catalog :
H00011214-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
5B7
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
product information
brand :
Novus
master code :
H00011214-M01
SKU :
H00011214-M01
product name :
AKAP13 Antibody (5B7)
unit size :
0.1 mg
seo description :
The AKAP13 Antibody (5B7) - Azide and BSA Free from Novus is a mouse monoclonal antibody to AKAP13. This antibody reacts with human. The AKAP13 Antibody (5B7) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.
target :
AKAP13
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
5B7
conjugate :
Unconjugated
dilution :
Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA
host :
Mouse
immunogen :
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGS
TLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEG
LPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ
AKAP13 (NP_006729, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
TLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEG
LPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ
AKAP13 (NP_006729, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human
specificity :
AKAP13 - A kinase (PRKA) anchor protein 13
gene symbol :
AKAP13
accessionNumbers :
NP_006729
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
A kinase (PRKA) anchor protein 13, AKAP-LbcAKAP-13, A-kinase anchor protein 13, A-kinase anchoring protein, ARHGEF13, Breast cancer nuclear receptor-binding auxiliary protein, BRXNon-oncogenic Rho GTPase-specific GTP exchange factor, c-lbc, FLJ11952, FLJ43341, Guanine nucleotide exchange factor Lbc, HA-3, HT31, Human thyroid-anchoring protein 31, LBCLBC oncogene, Lymphoid blast crisis oncogeneProtein kinase A-anchoring protein 13, p47, PROTO-LB, PROTO-LBC
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
