FGFR1OP Antibody (2B1) | Novus Biologicals H00011116-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

FGFR1OP Antibody (2B1)

catalog :

H00011116-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2B1

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, neutralization, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 18

Reference
Bunatyan L, Margineanu A, Boutin C, Montcouquiol M, Bachmann S, Ils xf8 Christensen E, et al. LRP2 contributes to planar cell polarity-dependent coordination of motile cilia function. Cell Tissue Res. 2023;392:535-551 pubmed publisher
Kanie T, Ng R, Abbott K, Pongs O, Jackson P. Myristoylated Neuronal Calcium Sensor-1 captures the ciliary vesicle at distal appendages. bioRxiv. 2023;: pubmed publisher
Kanie T, Love J, Fisher S, Gustavsson A, Jackson P. A hierarchical pathway for assembly of the distal appendages that organize primary cilia. bioRxiv. 2023;: pubmed publisher
Ortiz xc1 lvarez G, Fortoul A, Srivastava A, Moreau M, Bouloudi B, Mailhes Hamon C, et al. p53/p21 pathway activation contributes to the ependymal fate decision downstream of GemC1. Cell Rep. 2022;41:111810 pubmed publisher
Palla A, Hilgendorf K, Yang A, Kerr J, Hinken A, Demeter J, et al. Primary cilia on muscle stem cells are critical to maintain regenerative capacity and are lost during aging. Nat Commun. 2022;13:1439 pubmed publisher
Fujisawa S, Qiu H, Nozaki S, Chiba S, Katoh Y, Nakayama K. ARL3 and ARL13B GTPases participate in distinct steps of INPP5E targeting to the ciliary membrane. Biol Open. 2021;10: pubmed publisher
Wu C, Hilgendorf K, Bevacqua R, Hang Y, Demeter J, Kim S, et al. Discovery of ciliary G protein-coupled receptors regulating pancreatic islet insulin and glucagon secretion. Genes Dev. 2021;: pubmed publisher
Gon xe7 alves A, Hasselbalch S, Joensen B, Patzke S, Martens P, Ohlsen S, et al. CEP78 functions downstream of CEP350 to control biogenesis of primary cilia by negatively regulating CP110 levels. elife. 2021;10: pubmed publisher
Kobayashi T, Ishida Y, Hirano T, Katoh Y, Nakayama K. Cooperation of the IFT-A complex with the IFT-B complex is required for ciliary retrograde protein trafficking and GPCR import. Mol Biol Cell. 2021;32:45-56 pubmed publisher
Chouaib R, Safieddine A, Pichon X, Imbert A, Kwon O, Samacoits A, et al. A Dual Protein-mRNA Localization Screen Reveals Compartmentalized Translation and Widespread Co-translational RNA Targeting. Dev Cell. 2020;54:773-791.e5 pubmed publisher
Bonucci M, Kuperwasser N, Barbe S, Koka V, De Villeneuve D, Zhang C, et al. mTOR and S6K1 drive polycystic kidney by the control of Afadin-dependent oriented cell division. Nat Commun. 2020;11:3200 pubmed publisher
Hilgendorf K, Johnson C, Mezger A, Rice S, Norris A, Demeter J, et al. Omega-3 Fatty Acids Activate Ciliary FFAR4 to Control Adipogenesis. Cell. 2019;179:1289-1305.e21 pubmed publisher
Ortiz Álvarez G, Daclin M, Shihavuddin A, Lansade P, Fortoul A, Faucourt M, et al. Adult Neural Stem Cells and Multiciliated Ependymal Cells Share a Common Lineage Regulated by the Geminin Family Members. Neuron. 2019;102:159-172.e7 pubmed publisher
Mahuzier A, Shihavuddin A, Fournier C, Lansade P, Faucourt M, Menezes N, et al. Ependymal cilia beating induces an actin network to protect centrioles against shear stress. Nat Commun. 2018;9:2279 pubmed publisher
Kanie T, Abbott K, Mooney N, Plowey E, Demeter J, JACKSON P. The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base. Dev Cell. 2017;42:22-36.e12 pubmed publisher
Mazo G, Soplop N, Wang W, Uryu K, Tsou M. Spatial Control of Primary Ciliogenesis by Subdistal Appendages Alters Sensation-Associated Properties of Cilia. Dev Cell. 2016;39:424-437 pubmed publisher
Boutin C, Labedan P, Dimidschstein J, Richard F, Cremer H, Andre P, et al. A dual role for planar cell polarity genes in ciliated cells. Proc Natl Acad Sci U S A. 2014;111:E3129-38 pubmed publisher
Mano Y, Takahashi K, Ishikawa N, Takano A, Yasui W, Inai K, et al. Fibroblast growth factor receptor 1 oncogene partner as a novel prognostic biomarker and therapeutic target for lung cancer. Cancer Sci. 2007;98:1902-13 pubmed

product information

brand :

Novus

master code :

H00011116-M01

SKU :

H00011116-M01

product name :

FGFR1OP Antibody (2B1)

unit size :

0.1 mg

seo description :

The FGFR1OP Antibody (2B1) - Azide and BSA Free from Novus is a mouse monoclonal antibody to FGFR1OP. This antibody reacts with human,mouse,rabbit. The FGFR1OP Antibody (2B1) - Azide and BSA Free has been validated for the following applications: Block/Neutralize,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Frozen.

target :

FGFR1OP

category :

Primary Antibodies

buffer :

PBS (pH 7.4)

clonality :

Monoclonal

clone :

2B1

conjugate :

Unconjugated

dilution :

Western Blot 1:500, ELISA 1:100 - 1:2000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:10 - 1:500, Immunohistochemistry-Frozen

host :

Mouse

immunogen :

tag.MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKA
ELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLV
ASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARD
LGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLS
DVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEP
KSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDM
EGDSFFDDPIPKPEKTYGLRNEPRK
FGFR1OP (AAH11902, 1 a.a ~ 379 a.a) full length recombinant protein with GST

isotype :

IgG2b Kappa

purity :

IgG purified

species :

Human,Mouse,Rabbit

specificity :

FGFR1OP - FGFR1 oncogene partner

gene symbol :

CEP43

accessionNumbers :

AAH11902

applications :

ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Frozen,Block/Neutralize,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

FGFR1 oncogene partner, FOPfibroblast growth factor receptor 1 oncogene partner

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage