UbcH10/UBE2C Antibody (9D3) | Novus Biologicals H00011065-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

UbcH10/UBE2C Antibody (9D3)

catalog :

H00011065-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

9D3

reactivity :

human, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 13

Reference
Chiang A, Li C, Tsui K, Chang C, Chang Y, Chen L, et al. UBE2C Drives Human Cervical Cancer Progression and Is Positively Modulated by mTOR. Biomolecules. 2020;11: pubmed publisher
Liu P, Chen C, Shu C, Chang H, Lee C, Liou H, et al. UBE2C is a Potential Biomarker for Tumorigenesis and Prognosis in Tongue Squamous Cell Carcinoma. Diagnostics (Basel). 2020;10: pubmed publisher
Lin S, Yeh J, Tsai P, Chang T, Huang W, Lee S, et al. Inhibition of Neointima Hyperplasia, Inflammation, and Reactive Oxygen Species in Balloon-Injured Arteries by HVJ Envelope Vector-Mediated Delivery of Superoxide Dismutase Gene. Transl Stroke Res. 2018;: pubmed publisher
Mo C, Gao L, Zhu X, Wei K, Zeng J, Chen G, et al. The clinicopathological significance of UBE2C in breast cancer: a study based on immunohistochemistry, microarray and RNA-sequencing data. Cancer Cell Int. 2017;17:83 pubmed publisher
Guo L, Ding Z, Huang N, Huang Z, Zhang N, Xia Z. Forkhead Box M1 positively regulates UBE2C and protects glioma cells from autophagic death. Cell Cycle. 2017;16:1705-1718 pubmed publisher
Castelblanco E, Zafon C, Maravall J, Gallel P, Martínez M, Capel I, et al. APLP2, RRM2, and PRC1: New Putative Markers for the Differential Diagnosis of Thyroid Follicular Lesions. Thyroid. 2017;27:59-66 pubmed publisher
Chou C, Huang N, Jhuang S, Pan H, Peng N, Cheng J, et al. Ubiquitin-conjugating enzyme UBE2C is highly expressed in breast microcalcification lesions. PLoS ONE. 2014;9:e93934 pubmed publisher
Guo J, Li J, Yang Y, Zhou L, Zhang T, Zhao Y. Oligonucleotide microarray identifies genes differentially expressed during tumorigenesis of DMBA-induced pancreatic cancer in rats. PLoS ONE. 2013;8:e82910 pubmed publisher
Morikawa T, Kawai T, Abe H, Kume H, Homma Y, Fukayama M. UBE2C is a marker of unfavorable prognosis in bladder cancer after radical cystectomy. Int J Clin Exp Pathol. 2013;6:1367-74 pubmed
Fristrup N, Birkenkamp Demtroder K, Reinert T, Sanchez Carbayo M, Segersten U, Malmstrom P, et al. Multicenter validation of cyclin D1, MCM7, TRIM29, and UBE2C as prognostic protein markers in non-muscle-invasive bladder cancer. Am J Pathol. 2013;182:339-49 pubmed publisher
Jiang L, Wang T, Bao Y, Qian J, Wu X, Hu G, et al. A study of UbcH10 expression and its association with recurrence of meningiomas. J Surg Oncol. 2012;106:327-31 pubmed publisher
Chen S, Chen Y, Hu C, Jing H, Cao Y, Liu X. Association of clinicopathological features with UbcH10 expression in colorectal cancer. J Cancer Res Clin Oncol. 2010;136:419-26 pubmed publisher
Jiang L, Huang C, Lu Y, Luo C, Hu G, Liu H, et al. Expression of ubiquitin-conjugating enzyme E2C/UbcH10 in astrocytic tumors. Brain Res. 2008;1201:161-6 pubmed publisher

product information

brand :

Novus

master code :

H00011065-M01

SKU :

H00011065-M01

product name :

UbcH10/UBE2C Antibody (9D3)

unit size :

0.1 mg

seo description :

The UbcH10/UBE2C Antibody (9D3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to UbcH10/UBE2C. This antibody reacts with human,rat. The UbcH10/UBE2C Antibody (9D3) - Azide and BSA Free has been validated for the following applications: Western Blot,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

UbcH10/UBE2C

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

9D3

conjugate :

Unconjugated

dilution :

Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin

host :

Mouse

immunogen :

AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
TQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSP
LNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
UBE2C (NP_008950, 70 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Rat

specificity :

UBE2C - ubiquitin-conjugating enzyme E2C

gene symbol :

UBE2C

accessionNumbers :

NP_008950

applications :

ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Western Blot

USD :

529 USD

alt names :

cyclin-selective ubiquitin carrier protein, dJ447F3.2, EC 6.3.2.19, UbcH10, UBCH10mitotic-specific ubiquitin-conjugating enzyme, Ubiquitin carrier protein C, ubiquitin carrier protein E2-C, ubiquitin-conjugating enzyme E2 C, ubiquitin-conjugating enzyme E2C, Ubiquitin-protein ligase C

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage