WWP1 Antibody (1A7) | Novus Biologicals H00011059-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

WWP1 Antibody (1A7)

catalog :

H00011059-M01

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1A7

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 19

Reference
Kishikawa T, Higuchi H, Wang L, Panch N, Maymi V, Best S, et al. WWP1 inactivation enhances efficacy of PI3K inhibitors while suppressing their toxicities in breast cancer models. J Clin Invest. 2021;131: pubmed publisher
Hwang D, Kim M, Kim S, Kwon M, Kang Y, Kim D, et al. AMOTL2 mono-ubiquitination by WWP1 promotes contact inhibition by facilitating LATS activation. Life Sci Alliance. 2021;4: pubmed publisher
Novelli G, Liu J, Biancolella M, Alonzi T, Novelli A, Patten J, et al. Inhibition of HECT E3 ligases as potential therapy for COVID-19. Cell Death Dis. 2021;12:310 pubmed publisher
Wu Y, Qin J, Li F, Yang C, Li Z, Zhou Z, et al. USP3 promotes breast cancer cell proliferation by deubiquitinating KLF5. J Biol Chem. 2019;294:17837-17847 pubmed publisher
Nielsen C, Jernigan K, Diggins N, Webb D, MacGurn J. USP9X Deubiquitylates DVL2 to Regulate WNT Pathway Specification. Cell Rep. 2019;28:1074-1089.e5 pubmed publisher
Lee Y, Chen M, Lee J, Zhang J, Lin S, Fu T, et al. Reactivation of PTEN tumor suppressor for cancer treatment through inhibition of a MYC-WWP1 inhibitory pathway. Science. 2019;364: pubmed publisher
Chen J, Zhang W. High expression of WWP1 predicts poor prognosis and associates with tumor progression in human colorectal cancer. Am J Cancer Res. 2018;8:256-265 pubmed
Qin J, Zhou Z, Chen W, Wang C, Zhang H, Ge G, et al. BAP1 promotes breast cancer cell proliferation and metastasis by deubiquitinating KLF5. Nat Commun. 2015;6:8471 pubmed publisher
Basheer W, Harris B, Mentrup H, Abreha M, Thames E, Lea J, et al. Cardiomyocyte-specific overexpression of the ubiquitin ligase Wwp1 contributes to reduction in Connexin 43 and arrhythmogenesis. J Mol Cell Cardiol. 2015;88:1-13 pubmed publisher
Courivaud T, Ferrand N, Elkhattouti A, Kumar S, Levy L, Ferrigno O, et al. Functional Characterization of a WWP1/Tiul1 Tumor-derived Mutant Reveals a Paradigm of Its Constitutive Activation in Human Cancer. J Biol Chem. 2015;290:21007-18 pubmed publisher
Ge F, Chen W, Qin J, Zhou Z, Liu R, Liu L, et al. Ataxin-3 like (ATXN3L), a member of the Josephin family of deubiquitinating enzymes, promotes breast cancer proliferation by deubiquitinating KrÃ¼ppel-like factor 5 (KLF5). Oncotarget. 2015;6:21369-78 pubmed
Chaudhary N, Maddika S. WWP2-WWP1 ubiquitin ligase complex coordinated by PPM1G maintains the balance between cellular p73 and ?Np73 levels. Mol Cell Biol. 2014;34:3754-64 pubmed publisher
Cheng Q, Cao X, Yuan F, Li G, Tong T. Knockdown of WWP1 inhibits growth and induces apoptosis in hepatoma carcinoma cells through the activation of caspase3 and p53. Biochem Biophys Res Commun. 2014;448:248-54 pubmed publisher
Yeung B, Ho K, Yang X. WWP1 E3 ligase targets LATS1 for ubiquitin-mediated degradation in breast cancer cells. PLoS ONE. 2013;8:e61027 pubmed publisher
Shu L, Zhang H, Boyce B, Xing L. Ubiquitin E3 ligase Wwp1 negatively regulates osteoblast function by inhibiting osteoblast differentiation and migration. J Bone Miner Res. 2013;28:1925-35 pubmed publisher
Cao X, Xue L, Han L, Ma L, Chen T, Tong T. WW domain-containing E3 ubiquitin protein ligase 1 (WWP1) delays cellular senescence by promoting p27(Kip1) degradation in human diploid fibroblasts. J Biol Chem. 2011;286:33447-56 pubmed publisher
Peschiaroli A, Scialpi F, Bernassola F, el Sherbini E, Melino G. The E3 ubiquitin ligase WWP1 regulates ?Np63-dependent transcription through Lys63 linkages. Biochem Biophys Res Commun. 2010;402:425-30 pubmed publisher
Edwards T, Clowes V, Tsang H, Connell J, Sanderson C, Luzio J, et al. Endogenous spartin (SPG20) is recruited to endosomes and lipid droplets and interacts with the ubiquitin E3 ligases AIP4 and AIP5. Biochem J. 2009;423:31-9 pubmed publisher
Chen C, Zhou Z, Sheehan C, Slodkowska E, Sheehan C, Boguniewicz A, et al. Overexpression of WWP1 is associated with the estrogen receptor and insulin-like growth factor receptor 1 in breast carcinoma. Int J Cancer. 2009;124:2829-36 pubmed publisher

product information

brand :

Novus

master code :

H00011059-M01

SKU :

H00011059-M01

product name :

WWP1 Antibody (1A7)

unit size :

0.1 mg

seo description :

The WWP1 Antibody (1A7) - Azide and BSA Free from Novus is a mouse monoclonal antibody to WWP1. This antibody reacts with human,primate. The WWP1 Antibody (1A7) - Azide and BSA Free has been validated for the following applications: Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,ELISA,Immunohistochemistry,Immunocytochemistry/ Immunofluorescence.

target :

WWP1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1A7

conjugate :

Unconjugated

dilution :

Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 10ug/mL, Immunoprecipitation, Immunohistochemistry-Paraffin 3ug/mL

host :

Mouse

immunogen :

CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGID
NHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPA
PKPLASEPADDTVNGESSSFAPTDNASVTGT
WWP1 (NP_008944, 152 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

Ascites

species :

Human,Primate

specificity :

WWP1 - WW domain containing E3 ubiquitin protein ligase 1 (1A7)

gene symbol :

WWP1

applications :

ELISA,Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin

USD :

499 USD

alt names :

AIP5Nedd-4-like ubiquitin-protein ligase, atrophin-1 interacting protein 5, Atrophin-1-interacting protein 5, DKFZP434D2111, EC 6.3.2, EC 6.3.2.-, hSDRP1, NEDD4-like E3 ubiquitin-protein ligase WWP1, TGIF-interacting ubiquitin ligase 1, TIUL1, WW domain containing E3 ubiquitin protein ligase 1, WW domain-containing protein 1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage