FGL2/Fibroleukin Antibody (6D9) | Novus Biologicals H00010875-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

FGL2/Fibroleukin Antibody (6D9)

catalog :

H00010875-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6D9

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, flow cytometry, immunohistochemistry - paraffin section

citations: 13

Reference
Sun H, Chen J, Zhang H, Ni B, Van Velkinburgh J, Liu Y, et al. Von Willebrand factor protects against acute CCl4-induced hepatotoxicity through phospho-p38 MAPK signaling pathway inhibition. Immunol Res. 2017;65:1046-1058 pubmed publisher
Wang M, Liu J, Xi D, Luo X, Ning Q. Adenovirus-mediated artificial microRNA against human fibrinogen like protein 2 inhibits hepatocellular carcinoma growth. J Gene Med. 2016;18:102-11 pubmed publisher
Long R, You Y, Li W, Jin N, Huang S, Li T, et al. Sodium tanshinone IIA sulfonate ameliorates experimental coronary no-reflow phenomenon through down-regulation of FGL2. Life Sci. 2015;142:8-18 pubmed publisher
Sun Y, Xi D, Ding W, Wang F, Zhou H, Ning Q. Soluble FGL2, a novel effector molecule of activated hepatic stellate cells, regulates T-cell function in cirrhotic patients with hepatocellular carcinoma. Hepatol Int. 2014;8:567-75 pubmed publisher
Li W, Wang J, Long R, Su G, Bukhory D, Dai J, et al. Novel antibody against a glutamic acid-rich human fibrinogen-like protein 2-derived peptide near Ser91 inhibits hfgl2 prothrombinase activity. PLoS ONE. 2014;9:e94551 pubmed publisher
Xu G, Chen J, Yang F, Li G, Zheng L, Wu Y. C5a/C5aR pathway is essential for the pathogenesis of murine viral fulminant hepatitis by way of potentiating Fgl2/fibroleukin expression. Hepatology. 2014;60:114-24 pubmed publisher
Ye X, Huai J, Chen R, Ding J, Chen Y, Cai Z. Correlation of fibrinogen-like protein 2 with disease progression in patients with severe acute pancreatitis. Exp Ther Med. 2014;7:85-89 pubmed
Xi D, Wang M, Ye H, Luo X, Ning Q. Combined adenovirus-mediated artificial microRNAs targeting mfgl2, mFas, and mTNFR1 protect against fulminant hepatic failure in mice. PLoS ONE. 2013;8:e82330 pubmed publisher
Dong X, Ye X, Chen X, Chen T, Xie S, Li Q, et al. Intestinal and peripheral fibrinogen-like protein 2 expression in inflammatory bowel disease. Dig Dis Sci. 2014;59:769-77 pubmed publisher
Selzner N, Liu H, Boehnert M, Adeyi O, Shalev I, Bartczak A, et al. FGL2/fibroleukin mediates hepatic reperfusion injury by induction of sinusoidal endothelial cell and hepatocyte apoptosis in mice. J Hepatol. 2012;56:153-9 pubmed publisher
Liu Y, Xu S, Xiao F, Xiong Y, Wang X, Gao S, et al. The FGL2/fibroleukin prothrombinase is involved in alveolar macrophage activation in COPD through the MAPK pathway. Biochem Biophys Res Commun. 2010;396:555-61 pubmed publisher
Shalev I, Liu H, Koscik C, Bartczak A, Javadi M, Wong K, et al. Targeted deletion of fgl2 leads to impaired regulatory T cell activity and development of autoimmune glomerulonephritis. J Immunol. 2008;180:249-60 pubmed
O Brien M, Morrison J, Smith T. Expression of prothrombin and protease activated receptors in human myometrium during pregnancy and labor. Biol Reprod. 2008;78:20-6 pubmed

product information

brand :

Novus

master code :

H00010875-M01

SKU :

H00010875-M01

product name :

FGL2/Fibroleukin Antibody (6D9)

description :

The FGL2/Fibroleukin Antibody (6D9) from Novus Biologicals is a mouse monoclonal antibody to FGL2/Fibroleukin. This antibody reacts with human, mouse, rat. The FGL2/Fibroleukin Antibody (6D9) has been validated for the following applications: Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Functional, Sandwich ELISA.

target :

FGL2/Fibroleukin

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

6D9

conjugate :

Unconjugated

host :

Mouse

immunogen :

NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLP
PLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKL
QADDNGDPGRNGLLLPSTGAPG
FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

Protein A purified

species :

Human, Mouse, Rat

specificity :

FGL2 (6D9)

gene symbol :

FGL2

catalog number base :

H00010875-M01

accessionNumbers :

NP_006673

applications :

Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Functional, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

fibrinogen-like 2, Fibrinogen-like protein 2, fibroleukin, pT49T49

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.