AG-2/AGR2 Antibody (1C3) | Novus Biologicals H00010551-M03 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

AG-2/AGR2 Antibody (1C3)

catalog :

H00010551-M03

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1C3

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

citations: 12

Reference
Sommerova L, Ondrousková E, Vojtesek B, Hrstka R. Suppression of AGR2 in a TGF-Î²-induced Smad regulatory pathway mediates epithelial-mesenchymal transition. BMC Cancer. 2017;17:546 pubmed publisher
Procházková I, Lenco J, Fucikova A, Dresler J, Čápková L, Hrstka R, et al. Targeted proteomics driven verification of biomarker candidates associated with breast cancer aggressiveness. Biochim Biophys Acta Proteins Proteom. 2017;1865:488-498 pubmed publisher
Ahmad R, Nicora C, Shukla A, Smith R, Qian W, Liu A. An efficient method for native protein purification in the selected range from prostate cancer tissue digests. Chin Clin Oncol. 2016;5:78 pubmed publisher
Dong A, Wodziak D, Lowe A. Epidermal growth factor receptor (EGFR) signaling requires a specific endoplasmic reticulum thioredoxin for the post-translational control of receptor presentation to the cell surface. J Biol Chem. 2015;290:8016-27 pubmed publisher
Riener M, Thiesler T, Hellerbrand C, Amann T, Cathomas G, Fritzsche F, et al. Loss of anterior gradient-2 expression is an independent prognostic factor in colorectal carcinomas. Eur J Cancer. 2014;50:1722-1730 pubmed publisher
Gray T, Murray E, Nowicki M, Remnant L, Scherl A, Muller P, et al. Development of a fluorescent monoclonal antibody-based assay to measure the allosteric effects of synthetic peptides on self-oligomerization of AGR2 protein. Protein Sci. 2013;22:1266-78 pubmed publisher
Darb Esfahani S, Fritzsche F, Kristiansen G, Weichert W, Sehouli J, Braicu I, et al. Anterior gradient protein 2 (AGR2) is an independent prognostic factor in ovarian high-grade serous carcinoma. Virchows Arch. 2012;461:109-16 pubmed publisher
Wayner E, Quek S, Ahmad R, Ho M, Loprieno M, Zhou Y, et al. Development of an ELISA to detect the secreted prostate cancer biomarker AGR2 in voided urine. Prostate. 2012;72:1023-34 pubmed publisher
Lepreux S, Bioulac Sage P, Chevet E. Differential expression of the anterior gradient protein-2 is a conserved feature during morphogenesis and carcinogenesis of the biliary tree. Liver Int. 2011;31:322-8 pubmed publisher
Maslon M, Hrstka R, Vojtesek B, Hupp T. A divergent substrate-binding loop within the pro-oncogenic protein anterior gradient-2 forms a docking site for Reptin. J Mol Biol. 2010;404:418-38 pubmed publisher
Ambolet Camoit A, Bui L, Pierre S, Chevallier A, Marchand A, Coumoul X, et al. 2,3,7,8-tetrachlorodibenzo-p-dioxin counteracts the p53 response to a genotoxicant by upregulating expression of the metastasis marker agr2 in the hepatocarcinoma cell line HepG2. Toxicol Sci. 2010;115:501-12 pubmed publisher
Zhao L, Lee B, Brown D, Molloy M, Marx G, Pavlakis N, et al. Identification of candidate biomarkers of therapeutic response to docetaxel by proteomic profiling. Cancer Res. 2009;69:7696-703 pubmed publisher

product information

brand :

Novus

master code :

H00010551-M03

SKU :

H00010551-M03

product name :

AG-2/AGR2 Antibody (1C3)

description :

The AG-2/AGR2 Antibody (1C3) from Novus Biologicals is a mouse monoclonal antibody to AG-2/AGR2. This antibody reacts with human. The AG-2/AGR2 Antibody (1C3) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA.

target :

AG-2/AGR2

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1C3

conjugate :

Unconjugated

host :

Mouse

immunogen :

MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPK
LPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHL
DECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKH
LSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPAD
TALLLDNMKKALKLLKTEL
AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2b Kappa

purity :

Protein A purified

species :

Human

specificity :

AGR2 - anterior gradient 2 homolog (Xenopus laevis)

gene symbol :

AGR2

catalog number base :

H00010551-M03

accessionNumbers :

AAH15503

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

AG-2, AG2member 17, anterior gradient 2 homolog (Xenopus laevis), anterior gradient homolog 2 (Xenopus laevis), GOB-4, hAG-2, HPC8, secreted cement gland homolog

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.