TCIRG1 Antibody (6H3) - Azide and BSA Free | Novus Biologicals H00010312-M01-100ug product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

TCIRG1 Antibody (6H3) - Azide and BSA Free

catalog :

H00010312-M01-100ug

quantity :

100 ug

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6H3

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 5

Reference
Xian X, Moraghebi R, L xf6 fvall H, Fasth A, Henriksen K, Richter J, et al. Generation of gene-corrected functional osteoclasts from osteopetrotic induced pluripotent stem cells. Stem Cell Res Ther. 2020;11:179 pubmed publisher
Capo V, Penna S, Merelli I, Barcella M, Scala S, Basso Ricci L, et al. Expanded circulating hematopoietic stem/progenitor cells as novel cell source for the treatment of TCIRG1 osteopetrosis. Haematologica. 2021;106:74-86 pubmed publisher
Henriksen K, Andreassen K, Thudium C, Gudmann K, Moscatelli I, Crüger Hansen C, et al. A specific subtype of osteoclasts secretes factors inducing nodule formation by osteoblasts. Bone. 2012;51:353-61 pubmed publisher
Schinke T, Schilling A, Baranowsky A, Seitz S, Marshall R, Linn T, et al. Impaired gastric acidification negatively affects calcium homeostasis and bone mass. Nat Med. 2009;15:674-81 pubmed publisher
Schulz N, Dave M, Stehberger P, Chau T, Wagner C. Differential localization of vacuolar H+-ATPases containing a1, a2, a3, or a4 (ATP6V0A1-4) subunit isoforms along the nephron. Cell Physiol Biochem. 2007;20:109-20 pubmed

product information

master code :

H00010312-M01

SKU :

H00010312-M01-100ug

product name :

TCIRG1 Antibody (6H3) - Azide and BSA Free

unit size :

100 ug

description :

The TCIRG1 Antibody (6H3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to TCIRG1. This antibody reacts with human,mouse. The TCIRG1 Antibody (6H3) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Frozen.

target :

TCIRG1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

6H3

conjugate :

Unconjugated

host :

Mouse

immunogen :

QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPG
GPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASF
RELEQPLEHPVTGEPATWMTFL
TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

Ascites

species :

Human,Mouse

specificity :

TCIRG1 - T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 (6H3)

gene symbol :

TCIRG1

applications :

ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Frozen

USD :

499 USD

alt names :

a3, Atp6i, ATP6N1Cspecific 116-kDa vacuolar proton pump subunit, ATP6V0A3T-cell immune response cDNA 7, OC-116, OC-116 kDa, OC-116kDa, OC116Vph1, OPTB1, Osteoclastic proton pump 116 kDa subunit, Stv1, T-cell immune regulator 1, T-cell immune response cDNA7 protein, T-cell, immune regulator 1, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein aisoform 3, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3, TIRC7ATPase, H+ transporting, 116kD, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3, V-ATPase 116 kDa isoform a3, V-ATPase 116-kDa, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 3

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage