G3BP1 Antibody (2F3) - Azide and BSA Free | Novus Biologicals H00010146-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

G3BP1 Antibody (2F3) - Azide and BSA Free

catalog :

H00010146-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2F3

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Zhao M, Xia T, Xing J, Yin L, Li X, Pan J, et al. The stress granule protein G3BP1 promotes pre-condensation of cGAS to allow rapid responses to DNA. EMBO Rep. 2022;23:e53166 pubmed publisher
Cai H, Liu X, Zhang F, Han Q, Liu Z, Xue W, et al. G3BP1 Inhibition Alleviates Intracellular Nucleic Acid-Induced Autoimmune Responses. J Immunol. 2021;206:2453-2467 pubmed publisher
Lutz M, Worth M, Hinchman M, Parker J, Ledgerwood E. Mammalian orthoreovirus Infection is Enhanced in Cells Pre-Treated with Sodium Arsenite. Viruses. 2019;11: pubmed publisher
Liu Z, Cai H, Xue W, Wang M, Xia T, Li W, et al. G3BP1 promotes DNA binding and activation of cGAS. Nat Immunol. 2019;20:18-28 pubmed publisher
Martin S, Bellora N, González Vallinas J, Irimia M, Chebli K, de Toledo M, et al. Preferential binding of a stable G3BP ribonucleoprotein complex to intron-retaining transcripts in mouse brain and modulation of their expression in the cerebellum. J Neurochem. 2016;139:349-368 pubmed publisher
Kaehler C, Isensee J, Hucho T, Lehrach H, Krobitsch S. 5-Fluorouracil affects assembly of stress granules based on RNA incorporation. Nucleic Acids Res. 2014;42:6436-47 pubmed publisher
Martin S, Zekri L, Metz A, Maurice T, Chebli K, Vignes M, et al. Deficiency of G3BP1, the stress granules assembly factor, results in abnormal synaptic plasticity and calcium homeostasis in neurons. J Neurochem. 2013;125:175-84 pubmed publisher
Norazit A, Meedeniya A, Nguyen M, Mackay Sim A. Progressive loss of dopaminergic neurons induced by unilateral rotenone infusion into the medial forebrain bundle. Brain Res. 2010;1360:119-29 pubmed publisher

product information

master code :

H00010146-M01

SKU :

H00010146-M01

product name :

G3BP1 Antibody (2F3) - Azide and BSA Free

unit size :

0.1 mg

description :

The G3BP1 Antibody (2F3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to G3BP1. This antibody reacts with human,monkey,mouse,primate - macaca mulatta (rhesus macaque),rat. The G3BP1 Antibody (2F3) - Azide and BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockdown Validated.

target :

G3BP1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2F3

conjugate :

Unconjugated

host :

Mouse

immunogen :

KPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWA
SVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQ
IPPQRPQRDQRV
G3BP (AAH06997, 214 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Monkey,Mouse,Primate - Macaca mulatta (Rhesus Macaque),Rat

specificity :

G3BP - Ras-GTPase-activating protein SH3-domain-binding protein

gene symbol :

G3BP1

accessionNumbers :

AAH06997

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockdown Validated

USD :

529 USD

alt names :

ATP-dependent DNA helicase VIII, EC 3.6.1, EC 3.6.4.12, EC 3.6.4.13, G3BP-1, G3BPRas-GTPase-activating protein SH3-domain-binding protein, GAP binding protein, GAP SH3 domain-binding protein 1, GTPase activating protein (SH3 domain) binding protein 1, hDH VIII, HDH-VIII, MGC111040, ras GTPase-activating protein-binding protein 1, RasGAP-associated endoribonuclease G3BP

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage