USP15 Antibody (1C10) - Azide and BSA Free | Novus Biologicals H00009958-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

USP15 Antibody (1C10) - Azide and BSA Free

catalog :

H00009958-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1C10

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunocytochemistry, immunoprecipitation

more info or order :

Novus Biologicals product webpage

citations: 17

Reference
Martinez S, Wu S, Geuenich M, Malik A, Weber R, Woo T, et al. In vivo CRISPR screens reveal SCAF1 and USP15 as drivers of pancreatic cancer. Nat Commun. 2024;15:5266 pubmed publisher
Dubiel D, Wang J, Hartig R, Chaithongyot S, Dubiel W, Naumann M. Latent CSN-CRL complexes are crucial for curcumin-induced apoptosis and recruited during adipogenesis to lipid droplets via small GTPase RAB18. iScience. 2023;26:106468 pubmed publisher
Nishi H, Ono M, Ohno S, Yamanaka Z, Sasaki T, Ohyashiki K, et al. Hypoxia-induced paclitaxel resistance in cervical cancer modulated by miR-100 targeting of USP15. Gynecol Oncol Rep. 2023;45:101138 pubmed publisher
Gregersen L, Mitter R, Ugalde A, Nojima T, Proudfoot N, Agami R, et al. SCAF4 and SCAF8, mRNA Anti-Terminator Proteins. Cell. 2019;: pubmed publisher
Fielding A, Concannon M, Darling S, Rusilowicz Jones E, Sacco J, Prior I, et al. The deubiquitylase USP15 regulates topoisomerase II alpha to maintain genome integrity. Oncogene. 2018;37:2326-2342 pubmed publisher
Oikonomaki M, Bady P, Hegi M. Ubiquitin Specific Peptidase 15 (USP15) suppresses glioblastoma cell growth via stabilization of HECTD1 E3 ligase attenuating WNT pathway activity. Oncotarget. 2017;8:110490-110502 pubmed publisher
Chiang C, Pauli E, Biryukov J, Feister K, Meng M, White E, et al. The Human Papillomavirus E6 Oncoprotein Targets USP15 and TRIM25 To Suppress RIG-I-Mediated Innate Immune Signaling. J Virol. 2018;92: pubmed publisher
GarcÃa Caballero A, Gadotti V, Stemkowski P, Weiss N, Souza I, Hodgkinson V, et al. The deubiquitinating enzyme USP5 modulates neuropathic and inflammatory pain by enhancing Cav3.2 channel activity. Neuron. 2014;83:1144-58 pubmed publisher
Cornelissen T, Haddad D, Wauters F, Van Humbeeck C, Mandemakers W, Koentjoro B, et al. The deubiquitinase USP15 antagonizes Parkin-mediated mitochondrial ubiquitination and mitophagy. Hum Mol Genet. 2014;23:5227-42 pubmed publisher
Pauli E, Chan Y, Davis M, Gableske S, Wang M, Feister K, et al. The ubiquitin-specific protease USP15 promotes RIG-I-mediated antiviral signaling by deubiquitylating TRIM25. Sci Signal. 2014;7:ra3 pubmed publisher
Faronato M, Patel V, Darling S, Dearden L, Clague M, Urbé S, et al. The deubiquitylase USP15 stabilizes newly synthesized REST and rescues its expression at mitotic exit. Cell Cycle. 2013;12:1964-77 pubmed publisher
Fernandez Sanchez M, Sechet E, Margottin Goguet F, Rogge L, Bianchi E. The human COP9 signalosome protects ubiquitin-conjugating enzyme 3 (UBC3/Cdc34) from beta-transducin repeat-containing protein (betaTrCP)-mediated degradation. J Biol Chem. 2010;285:17390-7 pubmed publisher
Cayli S, Klug J, Chapiro J, Fröhlich S, Krasteva G, Orel L, et al. COP9 signalosome interacts ATP-dependently with p97/valosin-containing protein (VCP) and controls the ubiquitination status of proteins bound to p97/VCP. J Biol Chem. 2009;284:34944-53 pubmed publisher
Xu M, Takanashi M, Oikawa K, Tanaka M, Nishi H, Isaka K, et al. USP15 plays an essential role for caspase-3 activation during Paclitaxel-induced apoptosis. Biochem Biophys Res Commun. 2009;388:366-71 pubmed publisher
Vos R, Altreuter J, White E, Howley P. The ubiquitin-specific peptidase USP15 regulates human papillomavirus type 16 E6 protein stability. J Virol. 2009;83:8885-92 pubmed publisher
Miyauchi Y, Kato M, Tokunaga F, Iwai K. The COP9/signalosome increases the efficiency of von Hippel-Lindau protein ubiquitin ligase-mediated hypoxia-inducible factor-alpha ubiquitination. J Biol Chem. 2008;283:16622-31 pubmed publisher
Schweitzer K, Bozko P, Dubiel W, Naumann M. CSN controls NF-kappaB by deubiquitinylation of IkappaBalpha. EMBO J. 2007;26:1532-41 pubmed

product information

master code :

H00009958-M01

SKU :

H00009958-M01

product name :

USP15 Antibody (1C10) - Azide and BSA Free

unit size :

0.1 mg

description :

The USP15 Antibody (1C10) - Azide and BSA Free from Novus is a mouse monoclonal antibody to USP15. This antibody reacts with human,mouse,rat. The USP15 Antibody (1C10) - Azide and BSA Free has been validated for the following applications: ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence.

target :

USP15

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1C10

conjugate :

Unconjugated

host :

Mouse

immunogen :

MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFK
QWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQS
LKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKV
VEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKAD
TIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPD
STIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQS
C
USP15 (AAH20688, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Mouse,Rat

specificity :

USP15 (1C10)

gene symbol :

USP15

accessionNumbers :

AAH20688

applications :

ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

Deubiquitinating enzyme 15, EC 3.1.2.15, EC 3.4.19.12, KIAA0529ubiquitin carboxyl-terminal hydrolase 15, MGC131982, MGC149838, MGC74854, ubiquitin specific peptidase 15, ubiquitin specific protease 15, ubiquitin thioesterase 15, Ubiquitin thiolesterase 15, Ubiquitin-specific-processing protease 15, unph-2, UNPH4

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage