product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
OXSR1 Antibody (2A5) - Azide and BSA Free
catalog :
H00009943-M20
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2A5
reactivity :
human, mouse, rat
application :
western blot, ELISA
more info or order :
product information
master code :
H00009943-M20
SKU :
H00009943-M20
product name :
OXSR1 Antibody (2A5) - Azide and BSA Free
unit size :
0.1 mg
description :
The OXSR1 Antibody (2A5) - Azide and BSA Free from Novus is a mouse monoclonal antibody to OXSR1. This antibody reacts with human,mouse,rat. The OXSR1 Antibody (2A5) - Azide and BSA Free has been validated for the following applications: ELISA,Western Blot.
target :
OXSR1
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
2A5
conjugate :
Unconjugated
host :
Mouse
immunogen :
MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPK
KEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSY
YTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGV
LDESTIATILREVLEGLEYLHKNGQIHRDVKAGNILLGE
DGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAP
EVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMK
VLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQ
KDPEKRPTAAELLRHKFFQKAKNKEFLQEKTLQRAPTIS
ERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGK
AAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISA
HLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQE
TKIPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQEL
ISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTFKLASGV
EGSDIPDDGKLIGFAQLSIS
OXSR1 (AAH08726.1, 1 a.a. ~ 527 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
KEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSY
YTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGV
LDESTIATILREVLEGLEYLHKNGQIHRDVKAGNILLGE
DGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAP
EVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMK
VLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQ
KDPEKRPTAAELLRHKFFQKAKNKEFLQEKTLQRAPTIS
ERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGK
AAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISA
HLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQE
TKIPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQEL
ISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTFKLASGV
EGSDIPDDGKLIGFAQLSIS
OXSR1 (AAH08726.1, 1 a.a. ~ 527 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human,Mouse,Rat
specificity :
OXSR1 - oxidative-stress responsive 1
gene symbol :
OXSR1
accessionNumbers :
AAH08726
applications :
ELISA,Western Blot
USD :
499 USD
alt names :
EC 2.7.11, EC 2.7.11.1, KIAA1101OSR1serine/threonine-protein kinase OSR1, Oxidative stress-responsive 1 protein, oxidative-stress responsive 1
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
- PDLIM5 Antibody (3E11-F6) - Azide and BSA Free | H00010611-M01
- ERCC6L Antibody - Azide and BSA Free | H00054821-B01P
- MEK5 Antibody (M1-E6) - Azide and BSA Free | H00005607-M01
- Endothelin-3 Antibody (2A6-2A4) - Azide and BSA Free | H00001908-M01
- FRA2 Antibody (2B4-1C2) - Azide and BSA Free | H00002355-M01
questions and comments
