product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Mitofusin 2 Antibody (4H8) - Azide and BSA Free
catalog :
H00009927-M03
quantity :
0.1 mg
price :
509 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4H8
reactivity :
human, rat
application :
western blot, ELISA, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 40
Reference
Sarmah D, Sarkar A, Datta A, Ghosh B, Rana N, Sahu S, et al. Cardiolipin-Mediated Alleviation of Mitochondrial Dysfunction Is a Neuroprotective Effect of Statin in Animal Model of Ischemic Stroke. ACS Chem Neurosci. 2023;14:709-724 pubmed publisher
van der Kooij M, Rojas Charry L, Givehchi M, Wolf C, Bueno D, Arndt S, et al. Chronic social stress disrupts the intracellular redistribution of brain hexokinase 3 induced by shifts in peripheral glucose levels. J Mol Med (Berl). 2022;100:1441-1453 pubmed publisher
Wolf C, Pouya A, Bitar S, Pfeiffer A, Bueno D, Rojas Charry L, et al. GDAP1 loss of function inhibits the mitochondrial pyruvate dehydrogenase complex by altering the actin cytoskeleton. Commun Biol. 2022;5:541 pubmed publisher
Scrima R, Agriesti F, Pacelli C, Piccoli C, Pucci P, Amoresano A, et al. Myoglobin expression by alternative transcript in different mesenchymal stem cells compartments. Stem Cell Res Ther. 2022;13:209 pubmed publisher
Shen J, Fortier T, Zhao Y, Wang R, Burmeister M, Baehrecke E. Vmp1, Vps13D, and Marf/Mfn2 function in a conserved pathway to regulate mitochondria and ER contact in development and disease. Curr Biol. 2021;31:3028-3039.e7 pubmed publisher
Peruzzo R, Corrà S, Costa R, Brischigliaro M, Varanita T, Biasutto L, et al. Exploiting pyocyanin to treat mitochondrial disease due to respiratory complex III dysfunction. Nat Commun. 2021;12:2103 pubmed publisher
Chimienti G, Picca A, Fracasso F, Russo F, Orlando A, Riezzo G, et al. The Age-Sensitive Efficacy of Calorie Restriction on Mitochondrial Biogenesis and mtDNA Damage in Rat Liver. Int J Mol Sci. 2021;22: pubmed publisher
Ota A, Ishihara T, Ishihara N. Mitochondrial nucleoid morphology and respiratory function are altered in Drp1-deficient HeLa cells. J Biochem. 2020;167:287-294 pubmed publisher
Faustini G, Marchesan E, Zonta L, Bono F, Bottani E, Longhena F, et al. Alpha-Synuclein Preserves Mitochondrial Fusion and Function in Neuronal Cells. Oxid Med Cell Longev. 2019;2019:4246350 pubmed publisher
Antonucci S, Di Sante M, Sileikyte J, Deveraux J, Bauer T, Bround M, et al. A novel class of cardioprotective small-molecule PTP inhibitors. Pharmacol Res. 2020;151:104548 pubmed publisher
Wolf C, Zimmermann R, Thaher O, Bueno D, Wüllner V, Schäfer M, et al. The Charcot-Marie Tooth Disease Mutation R94Q in MFN2 Decreases ATP Production but Increases Mitochondrial Respiration under Conditions of Mild Oxidative Stress. Cells. 2019;8: pubmed publisher
Stacchiotti A, Grossi I, Garc xed a G xf3 mez R, Patel G, Salvi A, Lavazza A, et al. Melatonin Effects on Non-Alcoholic Fatty Liver Disease Are Related to MicroRNA-34a-5p/Sirt1 Axis and Autophagy. Cells. 2019;8: pubmed publisher
Donkervoort S, Sabouny R, Yun P, Gauquelin L, Chao K, Hu Y, et al. MSTO1 mutations cause mtDNA depletion, manifesting as muscular dystrophy with cerebellar involvement. Acta Neuropathol. 2019;138:1013-1031 pubmed publisher
Sabouny R, Wong R, Lee Glover L, Greenway S, Sinasac D, Khan A, et al. Characterization of the C584R variant in the mtDNA depletion syndrome gene FBXL4, reveals a novel role for FBXL4 as a regulator of mitochondrial fusion. Biochim Biophys Acta Mol Basis Dis. 2019;1865:165536 pubmed publisher
Costa R, Peruzzo R, Bachmann M, Montà G, Vicario M, Santinon G, et al. Impaired Mitochondrial ATP Production Downregulates Wnt Signaling via ER Stress Induction. Cell Rep. 2019;28:1949-1960.e6 pubmed publisher
Morani F, Doccini S, Sirica R, Paterno M, Pezzini F, Ricca I, et al. Functional Transcriptome Analysis in ARSACS KO Cell Model Reveals a Role of Sacsin in Autophagy. Sci Rep. 2019;9:11878 pubmed publisher
Zhou Q, Li H, Li Y, Tan M, Fan S, Cao C, et al. Inhibiting neddylation modification alters mitochondrial morphology and reprograms energy metabolism in cancer cells. JCI Insight. 2019;4: pubmed publisher
Ishikawa K, Yamamoto S, Hattori S, Nishimura N, Tani H, Mito T, et al. Acquired Expression of Mutant Mitofusin 2 Causes Progressive Neurodegeneration and Abnormal Behavior. J Neurosci. 2019;39:1588-1604 pubmed publisher
Esteves A, Palma A, Gomes R, Santos D, Silva D, Cardoso S. Acetylation as a major determinant to microtubule-dependent autophagy: Relevance to Alzheimer's and Parkinson disease pathology. Biochim Biophys Acta Mol Basis Dis. 2019;1865:2008-2023 pubmed publisher
Picca A, Sirago G, Pesce V, Lezza A, Calvani R, Bossola M, et al. Administration of Enalapril Started Late in Life Attenuates Hypertrophy and Oxidative Stress Burden, Increases Mitochondrial Mass, and Modulates Mitochondrial Quality Control Signaling in the Rat Heart. Biomolecules. 2018;8: pubmed publisher
Desmoulins L, Chrétien C, Paccoud R, Collins S, Cruciani Guglielmacci C, Galinier A, et al. Mitochondrial Dynamin-Related Protein 1 (DRP1) translocation in response to cerebral glucose is impaired in a rat model of early alteration in hypothalamic glucose sensing. Mol Metab. 2019;20:166-177 pubmed publisher
Larsen S, Lundby A, Dandanell S, Oberholzer L, Keiser S, Andersen A, et al. Four days of bed rest increases intrinsic mitochondrial respiratory capacity in young healthy males. Physiol Rep. 2018;6:e13793 pubmed publisher
Basso V, Marchesan E, Peggion C, Chakraborty J, von Stockum S, Giacomello M, et al. Regulation of ER-mitochondria contacts by Parkin via Mfn2. Pharmacol Res. 2018;138:43-56 pubmed publisher
Mattie S, Riemer J, Wideman J, McBride H. A new mitofusin topology places the redox-regulated C terminus in the mitochondrial intermembrane space. J Cell Biol. 2018;217:507-515 pubmed publisher
Zhao Y, Chen Y, Miao G, Zhao H, Qu W, Li D, et al. The ER-Localized Transmembrane Protein EPG-3/VMP1 Regulates SERCA Activity to Control ER-Isolation Membrane Contacts for Autophagosome Formation. Mol Cell. 2017;67:974-989.e6 pubmed publisher
Nicassio L, Fracasso F, Sirago G, Musicco C, Picca A, Marzetti E, et al. Dietary supplementation with acetyl-l-carnitine counteracts age-related alterations of mitochondrial biogenesis, dynamics and antioxidant defenses in brain of old rats. Exp Gerontol. 2017;98:99-109 pubmed publisher
Thaher O, Wolf C, Dey P, Pouya A, Wüllner V, Tenzer S, et al. The thiol switch C684 in Mitofusin-2 mediates redox-induced alterations of mitochondrial shape and respiration. Neurochem Int. 2018;117:167-173 pubmed publisher
Lundby C, Montero D, Gehrig S, Andersson Hall U, Kaiser P, Boushel R, et al. Physiological, biochemical, anthropometric, and biomechanical influences on exercise economy in humans. Scand J Med Sci Sports. 2017;27:1627-1637 pubmed publisher
Silva D, Esteves A, Oliveira C, Cardoso S. Mitochondrial Metabolism Power SIRT2-Dependent Deficient Traffic Causing Alzheimer's-Disease Related Pathology. Mol Neurobiol. 2017;54:4021-4040 pubmed publisher
Chen M, Chen Z, Wang Y, Tan Z, Zhu C, Li Y, et al. Mitophagy receptor FUNDC1 regulates mitochondrial dynamics and mitophagy. Autophagy. 2016;12:689-702 pubmed publisher
Oettinghaus B, D Alonzo D, Barbieri E, Restelli L, Savoia C, Licci M, et al. DRP1-dependent apoptotic mitochondrial fission occurs independently of BAX, BAK and APAF1 to amplify cell death by BID and oxidative stress. Biochim Biophys Acta. 2016;1857:1267-1276 pubmed publisher
Mignarri A, Rubegni A, Tessa A, Stefanucci S, Malandrini A, Cardaioli E, et al. Mitochondrial dysfunction in hereditary spastic paraparesis with mutations in DDHD1/SPG28. J Neurol Sci. 2016;362:287-91 pubmed publisher
Jacobs R, Lundby A, Fenk S, Gehrig S, Siebenmann C, Flück D, et al. Twenty-eight days of exposure to 3454 m increases mitochondrial volume density in human skeletal muscle. J Physiol. 2016;594:1151-66 pubmed publisher
Esteves A, G Fernandes M, Santos D, Januário C, Cardoso S. The Upshot of LRRK2 Inhibition to Parkinson's Disease Paradigm. Mol Neurobiol. 2015;52:1804-1820 pubmed publisher
Fiuza Luces C, Delmiro A, Soares Miranda L, Gonzalez Murillo A, Martínez Palacios J, Ramirez M, et al. Exercise training can induce cardiac autophagy at end-stage chronic conditions: insights from a graft-versus-host-disease mouse model. Brain Behav Immun. 2014;39:56-60 pubmed publisher
Russell A, Lamon S, Boon H, Wada S, Güller I, Brown E, et al. Regulation of miRNAs in human skeletal muscle following acute endurance exercise and short-term endurance training. J Physiol. 2013;591:4637-53 pubmed publisher
Lally J, Herbst E, Matravadia S, Maher A, Perry C, Ventura Clapier R, et al. Over-expressing mitofusin-2 in healthy mature mammalian skeletal muscle does not alter mitochondrial bioenergetics. PLoS ONE. 2013;8:e55660 pubmed publisher
Cosson P, Marchetti A, Ravazzola M, Orci L. Mitofusin-2 independent juxtaposition of endoplasmic reticulum and mitochondria: an ultrastructural study. PLoS ONE. 2012;7:e46293 pubmed publisher
Moran M, Rivera H, Sánchez Aragó M, Blazquez A, Merinero B, Ugalde C, et al. Mitochondrial bioenergetics and dynamics interplay in complex I-deficient fibroblasts. Biochim Biophys Acta. 2010;1802:443-53 pubmed publisher
Holloway G, Perry C, Thrush A, Heigenhauser G, Dyck D, Bonen A, et al. PGC-1alpha's relationship with skeletal muscle palmitate oxidation is not present with obesity despite maintained PGC-1alpha and PGC-1beta protein. Am J Physiol Endocrinol Metab. 2008;294:E1060-9 pubmed publisher
product information
master code :
H00009927-M03
SKU :
H00009927-M03
product name :
Mitofusin 2 Antibody (4H8) - Azide and BSA Free
unit size :
0.1 mg
description :
The Mitofusin 2 Antibody (4H8) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Mitofusin 2. This antibody reacts with human,rat. The Mitofusin 2 Antibody (4H8) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,RNA Inhibition.
target :
Mitofusin 2
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
4H8
conjugate :
Unconjugated
host :
Mouse
immunogen :
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHL
CQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKA
GWLDSELNMFTHQYLQPSR
MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
Ascites
species :
Human,Rat
gene symbol :
MFN2
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,RNA Inhibition
USD :
509 USD
alt names :
CMT2A, CMT2A2, CPRP1mitochondrial assembly regulatory factor, EC 3.6.5, EC 3.6.5.-, HSG, KIAA0214hyperplasia suppressor, MARF, mitofusin 2, mitofusin-2, Transmembrane GTPase MFN2
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.