Mitofusin 2 Antibody (6A8) - Azide and BSA Free | Novus Biologicals H00009927-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Mitofusin 2 Antibody (6A8) - Azide and BSA Free

catalog :

H00009927-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6A8

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 15

Reference
Vevea J, Chapman E. Mitofusin 2 Sustains the Axonal Mitochondrial Network to Support Presynaptic Ca2+ Homeostasis and the Synaptic Vesicle Cycle in Rat Hippocampal Axons. J Neurosci. 2023;43:3421-3438 pubmed publisher
Vicente Acosta A, Gimenez Cassina A, Diaz Nido J, Loría F. The smoothened agonist SAG reduces mitochondrial dysfunction and neurotoxicity of frataxin-deficient astrocytes. J Neuroinflammation. 2022;19:93 pubmed publisher
Bharat V, Hsieh C, Wang X. Mitochondrial Defects in Fibroblasts of Pathogenic MAPT Patients. Front Cell Dev Biol. 2021;9:765408 pubmed publisher
Aleo S, Del Dotto V, Fogazza M, Maresca A, Lodi T, Goffrini P, et al. Drug repositioning as a therapeutic strategy for neurodegenerations associated with OPA1 mutations. Hum Mol Genet. 2021;29:3631-3645 pubmed publisher
Liparulo I, Bergamini C, Bortolus M, Calonghi N, Gasparre G, Kurelac I, et al. Coenzyme Q biosynthesis inhibition induces HIF-1α stabilization and metabolic switch toward glycolysis. FEBS J. 2021;288:1956-1974 pubmed publisher
Maresca A, Del Dotto V, Capristo M, Scimonelli E, Tagliavini F, Morandi L, et al. DNMT1 mutations leading to neurodegeneration paradoxically reflect on mitochondrial metabolism. Hum Mol Genet. 2020;29:1864-1881 pubmed publisher
Hsieh C, Li L, Vanhauwaert R, Nguyen K, Davis M, Bu G, et al. Miro1 Marks Parkinson's Disease Subset and Miro1 Reducer Rescues Neuron Loss in Parkinson's Models. Cell Metab. 2019;30:1131-1140.e7 pubmed publisher
Kammoun M, Piquereau J, Nadal Desbarats L, M xea me S, Beuvin M, Bonne G, et al. Novel role of Tieg1 in muscle metabolism and mitochondrial oxidative capacities. Acta Physiol (Oxf). 2020;228:e13394 pubmed publisher
Zhao Y, Sun X, Hu D, Prosdocimo D, Hoppel C, Jain M, et al. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nat Commun. 2019;10:1371 pubmed publisher
Ferreira J, Campos J, Qvit N, Qi X, Bozi L, Bechara L, et al. A selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats. Nat Commun. 2019;10:329 pubmed publisher
Del Dotto V, Fogazza M, Musiani F, Maresca A, Aleo S, Caporali L, et al. Deciphering OPA1 mutations pathogenicity by combined analysis of human, mouse and yeast cell models. Biochim Biophys Acta Mol Basis Dis. 2018;1864:3496-3514 pubmed publisher
Sacks J, Mulya A, Fealy C, Huang H, Mosinski J, Pagadala M, et al. Effect of Roux-en-Y gastric bypass on liver mitochondrial dynamics in a rat model of obesity. Physiol Rep. 2018;6: pubmed publisher
Mattie S, Riemer J, Wideman J, McBride H. A new mitofusin topology places the redox-regulated C terminus in the mitochondrial intermembrane space. J Cell Biol. 2018;217:507-515 pubmed publisher
Cormio A, Musicco C, Gasparre G, Cormio G, Pesce V, Sardanelli A, et al. Increase in proteins involved in mitochondrial fission, mitophagy, proteolysis and antioxidant response in type I endometrial cancer as an adaptive response to respiratory complex I deficiency. Biochem Biophys Res Commun. 2017;491:85-90 pubmed publisher
Stacchiotti A, Favero G, Giugno L, Lavazza A, Reiter R, Rodella L, et al. Mitochondrial and metabolic dysfunction in renal convoluted tubules of obese mice: protective role of melatonin. PLoS ONE. 2014;9:e111141 pubmed publisher

product information

master code :

H00009927-M01

SKU :

H00009927-M01

product name :

Mitofusin 2 Antibody (6A8) - Azide and BSA Free

unit size :

0.1 mg

description :

The Mitofusin 2 Antibody (6A8) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Mitofusin 2. This antibody reacts with human,mouse,rat. The Mitofusin 2 Antibody (6A8) - Azide and BSA Free has been validated for the following applications: IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

Mitofusin 2

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

6A8

conjugate :

Unconjugated

host :

Mouse

immunogen :

FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHL
CQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKA
GWLDSELNMFTHQYLQPSR
MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse,Rat

specificity :

MFN2 (6A8)

gene symbol :

MFN2

accessionNumbers :

NP_055689

applications :

IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

CMT2A, CMT2A2, CPRP1mitochondrial assembly regulatory factor, EC 3.6.5, EC 3.6.5.-, HSG, KIAA0214hyperplasia suppressor, MARF, mitofusin 2, mitofusin-2, Transmembrane GTPase MFN2

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage