product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
TOMM20 Antibody (4F3) - Azide and BSA Free
catalog :
H00009804-M01
quantity :
0.1 mg
price :
529 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4F3
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
more info or order :
Novus Biologicals product webpage
citations: 20
Reference
So H, Kim H, Lee J, You C, Yun C, Jeong H, et al. Protein Arginine Methyltransferase 1 Ablation in Motor Neurons Causes Mitochondrial Dysfunction Leading to Age-related Motor Neuron Degeneration with Muscle Loss. Research (Wash D C). 2023;6:0158 pubmed publisher
Greiser M, Karbowski M, Kaplan A, Coleman A, Verhoeven N, Mannella C, et al. Calcium and bicarbonate signaling pathways have pivotal, resonating roles in matching ATP production to demand. elife. 2023;12: pubmed publisher
Pandey J, Larson Casey J, Patil M, Joshi R, Jiang C, Zhou Y, et al. NOX4-TIM23 interaction regulates NOX4 mitochondrial import and metabolic reprogramming. J Biol Chem. 2023;299:104695 pubmed publisher
Cheng S, Altmeppen G, So C, Welp L, Penir S, Ruhwedel T, et al. Mammalian oocytes store mRNAs in a mitochondria-associated membraneless compartment. Science. 2022;378:eabq4835 pubmed publisher
Kim S, Ahn B, Tran T, Pyun J, Kang J, Leem Y. PRMT1 suppresses doxorubicin-induced cardiotoxicity by inhibiting endoplasmic reticulum stress. Cell Signal. 2022;98:110412 pubmed publisher
Császár E, Lénárt N, Cserép C, Kornyei Z, Fekete R, Pósfai B, et al. Microglia modulate blood flow, neurovascular coupling, and hypoperfusion via purinergic actions. J Exp Med. 2022;219: pubmed publisher
Parma B, Ramesh V, Gollavilli P, Siddiqui A, Pinna L, Schwab A, et al. Metabolic impairment of non-small cell lung cancers by mitochondrial HSPD1 targeting. J Exp Clin Cancer Res. 2021;40:248 pubmed publisher
Dorion M, Mulumba M, Kasai S, Itoh K, Lubell W, Ong H. The CD36 Ligand-Promoted Autophagy Protects Retinal Pigment Epithelial Cells from Oxidative Stress. Oxid Med Cell Longev. 2021;2021:6691402 pubmed publisher
Shin S, Nam Y, Park Y, Kim M, Lee E, Jeon S, et al. Therapeutic effects of non-saponin fraction with rich polysaccharide from Korean red ginseng on aging and Alzheimer's disease. Free Radic Biol Med. 2021;164:233-248 pubmed publisher
Yazdankhah M, Ghosh S, Shang P, Stepicheva N, Hose S, Liu H, et al. BNIP3L-mediated mitophagy is required for mitochondrial remodeling during the differentiation of optic nerve oligodendrocytes. Autophagy. 2021;:1-20 pubmed publisher
Lewis C, Dixit B, Batiuk E, Hall C, O Connor M, Boominathan A. Codon optimization is an essential parameter for the efficient allotopic expression of mtDNA genes. Redox Biol. 2020;30:101429 pubmed publisher
Tsitoura E, Vasarmidi E, Bibaki E, Trachalaki A, Koutoulaki C, Papastratigakis G, et al. Accumulation of damaged mitochondria in alveolar macrophages with reduced OXPHOS related gene expression in IPF. Respir Res. 2019;20:264 pubmed publisher
Lizama B, Palubinsky A, Raveendran V, Moore A, Federspiel J, Codreanu S, et al. Neuronal Preconditioning Requires the Mitophagic Activity of C-terminus of HSC70-Interacting Protein. J Neurosci. 2018;38:6825-6840 pubmed publisher
Wu M, Liu X, Chi X, Zhang L, Xiong W, Chiang S, et al. Mitophagy in Refractory Temporal Lobe Epilepsy Patients with Hippocampal Sclerosis. Cell Mol Neurobiol. 2018;38:479-486 pubmed publisher
Sidjanin D, Park A, Ronchetti A, Martins J, Jackson W. TBC1D20 mediates autophagy as a key regulator of autophagosome maturation. Autophagy. 2016;12:1759-1775 pubmed
Lood C, Blanco L, Purmalek M, Carmona Rivera C, De Ravin S, Smith C, et al. Neutrophil extracellular traps enriched in oxidized mitochondrial DNA are interferogenic and contribute to lupus-like disease. Nat Med. 2016;22:146-53 pubmed publisher
Kanfer G, Courtheoux T, Peterka M, Meier S, Soste M, Melnik A, et al. Mitotic redistribution of the mitochondrial network by Miro and Cenp-F. Nat Commun. 2015;6:8015 pubmed publisher
Grillon E, Farion R, Reuveni M, Glidle A, Rémy C, Coles J. Spatial profiles of markers of glycolysis, mitochondria, and proton pumps in a rat glioma suggest coordinated programming for proliferation. BMC Res Notes. 2015;8:207 pubmed publisher
Grozdanov P, Stocco D. Short RNA molecules with high binding affinity to the KH motif of A-kinase anchoring protein 1 (AKAP1): implications for the regulation of steroidogenesis. Mol Endocrinol. 2012;26:2104-17 pubmed publisher
Murmu R, Martin E, Rastetter A, Esteves T, Muriel M, El Hachimi K, et al. Cellular distribution and subcellular localization of spatacsin and spastizin, two proteins involved in hereditary spastic paraplegia. Mol Cell Neurosci. 2011;47:191-202 pubmed publisher
product information
master code :
H00009804-M01
SKU :
H00009804-M01
product name :
TOMM20 Antibody (4F3) - Azide and BSA Free
unit size :
0.1 mg
description :
The TOMM20 Antibody (4F3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to TOMM20. This antibody reacts with human,mouse,rat. The TOMM20 Antibody (4F3) - Azide and BSA Free has been validated for the following applications: Immunohistochemistry,Flow Cytometry,Western Blot,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry-Paraffin.
target :
TOMM20
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
4F3
conjugate :
Unconjugated
host :
Mouse
immunogen :
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLR
ERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGE
ELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPP
VFQMLLTKLPTISQRIVSAQSLAEDDVE
TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
IgG purified
species :
Human,Mouse,Rat
specificity :
TOMM20 - translocase of outer mitochondrial membrane 20 homolog (yeast)
gene symbol :
TOMM20
accessionNumbers :
AAH66335
applications :
Immunohistochemistry,Flow Cytometry,Western Blot,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry-Paraffin
USD :
529 USD
alt names :
KIAA0016Outer mitochondrial membrane receptor Tom20, MAS20, MGC117367, Mitochondrial 20 kDa outer membrane protein, mitochondrial import receptor subunit TOM20 homolog, MOM19, TOM20, translocase of outer mitochondrial membrane 20 homolog (yeast), translocase of outer mitochondrial membrane 20 homolog type II
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
Novus Biologicals product webpage
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.