PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free | Novus Biologicals H00009768-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free

catalog :

H00009768-M01

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3C11-1F11

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 10

Reference
Tantiwetrueangdet A, Panvichian R, Sornmayura P, Leelaudomlipi S, Macoska J. PCNA-associated factor (KIAA0101/PCLAF) overexpression and gene copy number alterations in hepatocellular carcinoma tissues. BMC Cancer. 2021;21:295 pubmed publisher
Cao H, Zheng J, Yao Y, Yang Q, Yan R, Sun W, et al. Overexpression of KIAA0101 Promotes the Progression of Non-small Cell Lung Cancer. J Cancer. 2020;11:6663-6674 pubmed publisher
Sun T, An Q, Yan R, Li K, Zhu K, Dang C, et al. MicroRNA‑216a‑5p suppresses esophageal squamous cell carcinoma progression by targeting KIAA0101. Oncol Rep. 2020;44:1971-1984 pubmed publisher
Ong D, Hu B, Ho Y, Sauvé C, Bristow C, Wang Q, et al. PAF promotes stemness and radioresistance of glioma stem cells. Proc Natl Acad Sci U S A. 2017;114:E9086-E9095 pubmed publisher
Yuan D, Zhu K, Dang C, Zheng Y, Yan R, Shi L, et al. NS5ATP9 mRNA levels in peripheral blood mononuclear cells predict prognosis in patients with gastric cancer. Med Oncol. 2014;31:106 pubmed publisher
Cheng Y, Li K, Diao D, Zhu K, Shi L, Zhang H, et al. Expression of KIAA0101 protein is associated with poor survival of esophageal cancer patients and resistance to cisplatin treatment in vitro. Lab Invest. 2013;93:1276-87 pubmed publisher
Chang C, Feng M, Chen Y, Yuan R, Jeng Y. p15(PAF) is an Rb/E2F-regulated S-phase protein essential for DNA synthesis and cell cycle progression. PLoS ONE. 2013;8:e61196 pubmed publisher
Shubbar E, Kovács A, Hajizadeh S, Parris T, Nemes S, Gunnarsdóttir K, et al. Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome. BMC Cancer. 2013;13:1 pubmed publisher
Kato T, Daigo Y, Aragaki M, Ishikawa K, Sato M, Kaji M. Overexpression of KIAA0101 predicts poor prognosis in primary lung cancer patients. Lung Cancer. 2012;75:110-8 pubmed publisher
Yuan R, Jeng Y, Pan H, Hu F, Lai P, Lee P, et al. Overexpression of KIAA0101 predicts high stage, early tumor recurrence, and poor prognosis of hepatocellular carcinoma. Clin Cancer Res. 2007;13:5368-76 pubmed

product information

master code :

H00009768-M01

SKU :

H00009768-M01

product name :

PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free

unit size :

0.1 mg

description :

The PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free from Novus is a mouse monoclonal antibody to PCNA associated factor. This antibody reacts with human. The PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free has been validated for the following applications: IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

PCNA associated factor

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3C11-1F11

conjugate :

Unconjugated

host :

Mouse

immunogen :

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVS
SRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEK
ENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
KIAA0101 (AAH05832, 1 a.a. ~ 111 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human

specificity :

KIAA0101 - KIAA0101

gene symbol :

PCLAF

accessionNumbers :

AAH05832

applications :

IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

499 USD

alt names :

HCV NS5A-transactivated protein 9, Hepatitis C virus NS5A-transactivated protein 9, KIAA0101, NS5ATP9p15PAF, OEATC-1OEATC1, Overexpressed in anaplastic thyroid carcinoma 1, p15(PAF), PAF, PCNA-associated factor

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage