product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free
catalog :
H00009768-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C11-1F11
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 10
Reference
Tantiwetrueangdet A, Panvichian R, Sornmayura P, Leelaudomlipi S, Macoska J. PCNA-associated factor (KIAA0101/PCLAF) overexpression and gene copy number alterations in hepatocellular carcinoma tissues. BMC Cancer. 2021;21:295 pubmed publisher
Cao H, Zheng J, Yao Y, Yang Q, Yan R, Sun W, et al. Overexpression of KIAA0101 Promotes the Progression of Non-small Cell Lung Cancer. J Cancer. 2020;11:6663-6674 pubmed publisher
Sun T, An Q, Yan R, Li K, Zhu K, Dang C, et al. MicroRNA‑216a‑5p suppresses esophageal squamous cell carcinoma progression by targeting KIAA0101. Oncol Rep. 2020;44:1971-1984 pubmed publisher
Ong D, Hu B, Ho Y, Sauvé C, Bristow C, Wang Q, et al. PAF promotes stemness and radioresistance of glioma stem cells. Proc Natl Acad Sci U S A. 2017;114:E9086-E9095 pubmed publisher
Yuan D, Zhu K, Dang C, Zheng Y, Yan R, Shi L, et al. NS5ATP9 mRNA levels in peripheral blood mononuclear cells predict prognosis in patients with gastric cancer. Med Oncol. 2014;31:106 pubmed publisher
Cheng Y, Li K, Diao D, Zhu K, Shi L, Zhang H, et al. Expression of KIAA0101 protein is associated with poor survival of esophageal cancer patients and resistance to cisplatin treatment in vitro. Lab Invest. 2013;93:1276-87 pubmed publisher
Chang C, Feng M, Chen Y, Yuan R, Jeng Y. p15(PAF) is an Rb/E2F-regulated S-phase protein essential for DNA synthesis and cell cycle progression. PLoS ONE. 2013;8:e61196 pubmed publisher
Shubbar E, Kovács A, Hajizadeh S, Parris T, Nemes S, Gunnarsdóttir K, et al. Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome. BMC Cancer. 2013;13:1 pubmed publisher
Kato T, Daigo Y, Aragaki M, Ishikawa K, Sato M, Kaji M. Overexpression of KIAA0101 predicts poor prognosis in primary lung cancer patients. Lung Cancer. 2012;75:110-8 pubmed publisher
Yuan R, Jeng Y, Pan H, Hu F, Lai P, Lee P, et al. Overexpression of KIAA0101 predicts high stage, early tumor recurrence, and poor prognosis of hepatocellular carcinoma. Clin Cancer Res. 2007;13:5368-76 pubmed
product information
brand :
Novus
catalog number base :
H00009768-M01
SKU :
H00009768-M01
product name :
PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free
units size :
0.1 mg
description :
The PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free from Novus is a mouse monoclonal antibody to PCNA associated factor. This antibody reacts with human. The PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free has been validated for the following applications: IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
PCNA associated factor
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
3C11-1F11
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Mouse
immunogen :
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVS
SRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEK
ENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
KIAA0101 (AAH05832, 1 a.a. ~ 111 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
IgG purified
species :
Human
specificity :
EIF4E2 - eukaryotic translation initiation factor 4E member 2 (1F3)
gene symbol :
PCLAF
top caption :
Western Blot: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01]
accessionNumbers :
AAH05832
applications :
IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
HCV NS5A-transactivated protein 9, Hepatitis C virus NS5A-transactivated protein 9, KIAA0101, NS5ATP9p15PAF, OEATC-1OEATC1, Overexpressed in anaplastic thyroid carcinoma 1, p15(PAF), PAF, PCNA-associated factor
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.