Separase Antibody (6H6) - Azide and BSA Free | Novus Biologicals H00009700-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Separase Antibody (6H6) - Azide and BSA Free

catalog :

H00009700-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6H6

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 13

Reference
Omairi H, Grisdale C, Meode M, Bohm A, Black S, Adam N, et al. Mitogen-induced defective mitosis transforms neural progenitor cells. Neuro Oncol. 2023;25:1763-1774 pubmed publisher
Vihervuori H, Korpinen K, Autere T, Repo H, Talvinen K, Kronqvist P. Varying outcomes of triple-negative breast cancer in different age groups-prognostic value of clinical features and proliferation. Breast Cancer Res Treat. 2022;196:471-482 pubmed publisher
Thomas C, Wetherall B, Levasseur M, Harris R, Kerridge S, Higgins J, et al. A prometaphase mechanism of securin destruction is essential for meiotic progression in mouse oocytes. Nat Commun. 2021;12:4322 pubmed publisher
Galofr xe9 C, Asensio E, Ubach M, Torres I, Quintanilla I, Castells A, et al. Centrosome reduction in newly-generated tetraploid cancer cells obtained by separase depletion. Sci Rep. 2020;10:9152 pubmed publisher
Vihervuori H, Autere T, Repo H, Kurki S, Kallio L, Lintunen M, et al. Tumor-infiltrating lymphocytes and CD8+ T cells predict survival of triple-negative breast cancer. J Cancer Res Clin Oncol. 2019;145:3105-3114 pubmed publisher
Gurvits N, Löyttyniemi E, Nykanen M, Kuopio T, Kronqvist P, Talvinen K. Separase is a marker for prognosis and mitotic activity in breast cancer. Br J Cancer. 2017;117:1383-1391 pubmed publisher
Mukherjee M, Byrd T, Brawley V, Bielamowicz K, Li X, Merchant F, et al. Overexpression and constitutive nuclear localization of cohesin protease Separase protein correlates with high incidence of relapse and reduced overall survival in glioblastoma multiforme. J Neurooncol. 2014;119:27-35 pubmed publisher
Zhang N, Scorsone K, Ge G, Kaffes C, Dobrolecki L, Mukherjee M, et al. Identification and Characterization of Separase Inhibitors (Sepins) for Cancer Therapy. J Biomol Screen. 2014;19:878-89 pubmed publisher
Mukherjee M, Ge G, Zhang N, Edwards D, Sumazin P, Sharan S, et al. MMTV-Espl1 transgenic mice develop aneuploid, estrogen receptor alpha (ER?)-positive mammary adenocarcinomas. Oncogene. 2014;33:5511-5522 pubmed publisher
Panigrahi A, Zhang N, Mao Q, Pati D. Calpain-1 cleaves Rad21 to promote sister chromatid separation. Mol Cell Biol. 2011;31:4335-47 pubmed publisher
Mukherjee M, Ge G, Zhang N, Huang E, Nakamura L, Minor M, et al. Separase loss of function cooperates with the loss of p53 in the initiation and progression of T- and B-cell lymphoma, leukemia and aneuploidy in mice. PLoS ONE. 2011;6:e22167 pubmed publisher
Meyer R, Fofanov V, Panigrahi A, Merchant F, Zhang N, Pati D. Overexpression and mislocalization of the chromosomal segregation protein separase in multiple human cancers. Clin Cancer Res. 2009;15:2703-10 pubmed publisher
Zhang N, Ge G, Meyer R, Sethi S, Basu D, Pradhan S, et al. Overexpression of Separase induces aneuploidy and mammary tumorigenesis. Proc Natl Acad Sci U S A. 2008;105:13033-8 pubmed publisher

product information

master code :

H00009700-M01

SKU :

H00009700-M01

product name :

Separase Antibody (6H6) - Azide and BSA Free

unit size :

0.1 mg

description :

The Separase Antibody (6H6) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Separase. This antibody reacts with human,mouse. The Separase Antibody (6H6) - Azide and BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Western Blot.

target :

Separase

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

6H6

conjugate :

Unconjugated

host :

Mouse

immunogen :

REELQAYKAVRADTGQERFNIICDLLELSPEETPAGAWA
RATHLVELAQVLCYHDFTQQTNCSALDAIREALQLLDSV
RPEAQARDQLLDDKAQALLWLYICTLEAKIQEGIERDR
ESPL1 (NP_036423, 586 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

ESPL1 - extra spindle poles like 1 (S

gene symbol :

ESPL1

accessionNumbers :

NP_036423

applications :

IF/IHC,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Western Blot

USD :

529 USD

alt names :

Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage