Peroxiredoxin 6 Antibody (3A10-2A11) - Azide and BSA Free | Novus Biologicals H00009588-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Peroxiredoxin 6 Antibody (3A10-2A11) - Azide and BSA Free

catalog :

H00009588-M01

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3A10-2A11

reactivity :

human, bovine

application :

western blot, ELISA, dot blot

more info or order :

Novus Biologicals product webpage

citations: 12

Reference
Picard B, Cougoul A, Couvreur S, Bonnet M. Relationships between the abundance of 29 proteins and several meat or carcass quality traits in two bovine muscles revealed by a combination of univariate and multivariate analyses. J Proteomics. 2023;273:104792 pubmed publisher
Picard B, Gagaoua M, Al Jammas M, Bonnet M. Beef tenderness and intramuscular fat proteomic biomarkers: Effect of gender and rearing practices. J Proteomics. 2019;200:1-10 pubmed publisher
Romanello K, Teixeira K, Silva J, Nagamatsu S, Bezerra M, Domingos I, et al. Global analysis of erythroid cells redox status reveals the involvement of Prdx1 and Prdx2 in the severity of beta thalassemia. PLoS ONE. 2018;13:e0208316 pubmed publisher
Gagaoua M, Bonnet M, de Koning L, Picard B. Reverse Phase Protein array for the quantification and validation of protein biomarkers of beef qualities: The case of meat color from Charolais breed. Meat Sci. 2018;145:308-319 pubmed publisher
Picard B, Gagaoua M, Al Jammas M, de Koning L, Valais A, Bonnet M. Beef tenderness and intramuscular fat proteomic biomarkers: muscle type effect. Peerj. 2018;6:e4891 pubmed publisher
Gagaoua M, Bonnet M, Ellies Oury M, de Koning L, Picard B. Reverse phase protein arrays for the identification/validation of biomarkers of beef texture and their use for early classification of carcasses. Food Chem. 2018;250:245-252 pubmed publisher
Gagaoua M, Terlouw E, Picard B. The study of protein biomarkers to understand the biochemical processes underlying beef color development in young bulls. Meat Sci. 2017;134:18-27 pubmed publisher
Gagaoua M, Terlouw E, Boudjellal A, Picard B. Coherent correlation networks among protein biomarkers of beef tenderness: What they reveal. J Proteomics. 2015;128:365-74 pubmed publisher
Picard B, Gagaoua M, Micol D, Cassar Malek I, Hocquette J, Terlouw C. Inverse relationships between biomarkers and beef tenderness according to contractile and metabolic properties of the muscle. J Agric Food Chem. 2014;62:9808-18 pubmed publisher
Guillemin N, Bonnet M, Jurie C, Picard B. Functional analysis of beef tenderness. J Proteomics. 2011;75:352-65 pubmed publisher
Taga H, Chilliard Y, Meunier B, Chambon C, Picard B, Zingaretti M, et al. Cellular and molecular large-scale features of fetal adipose tissue: is bovine perirenal adipose tissue brown?. J Cell Physiol. 2012;227:1688-700 pubmed publisher
Jia X, Veiseth Kent E, Grove H, Kuziora P, Aass L, Hildrum K, et al. Peroxiredoxin-6--a potential protein marker for meat tenderness in bovine longissimus thoracis muscle. J Anim Sci. 2009;87:2391-9 pubmed publisher

product information

master code :

H00009588-M01

SKU :

H00009588-M01

product name :

Peroxiredoxin 6 Antibody (3A10-2A11) - Azide and BSA Free

unit size :

0.1 mg

description :

The Peroxiredoxin 6 Antibody (3A10-2A11) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Peroxiredoxin 6. This antibody reacts with bovine,human. The Peroxiredoxin 6 Antibody (3A10-2A11) - Azide and BSA Free has been validated for the following applications: Cytometric Bead Assay Standard,Western Blot,ELISA,Dot Blot.

target :

Peroxiredoxin 6

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3A10-2A11

conjugate :

Unconjugated

host :

Mouse

immunogen :

MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSH
PRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVED
HLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGML
DPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRN
FDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPE
EEAKKLFPKGVFTKELPSGKKYLRYTPQP
PRDX6 (AAH35857.1, 1 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Bovine,Human

specificity :

PRDX6 - peroxiredoxin 6

gene symbol :

PRDX6

accessionNumbers :

AAH35857

applications :

Cytometric Bead Assay Standard,Western Blot,ELISA,Dot Blot

USD :

499 USD

alt names :

1-Cys, 24 kDa protein, Acidic calcium-independent phospholipase A2, aiPLA21-Cys PRX, Antioxidant protein 2, AOP2Non-selenium glutathione peroxidase, EC 1.11.1.15, EC 1.11.1.7, EC 3.1.1.-, KIAA0106Red blood cells page spot 12, Liver 2D page spot 40, MGC46173, NSGPx1-Cys peroxiredoxin, p29, peroxiredoxin 6, peroxiredoxin-6, PRX

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage