product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
EIF4E2 Antibody (4G10) - Azide and BSA Free
catalog :
H00009470-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4G10
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
product information
master code :
H00009470-M01
SKU :
H00009470-M01
product name :
EIF4E2 Antibody (4G10) - Azide and BSA Free
unit size :
0.1 mg
description :
The EIF4E2 Antibody (4G10) - Azide and BSA Free from Novus is a mouse monoclonal antibody to EIF4E2. This antibody reacts with human. The EIF4E2 Antibody (4G10) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
EIF4E2
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
4G10
conjugate :
Unconjugated
host :
Mouse
immunogen :
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQ
SSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSY
EQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFK
EGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAML
GEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTAR
IRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLF
QNLWKPRLNVP
EIF4E2 (AAH05392, 1 a.a. ~ 245 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
SSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSY
EQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFK
EGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAML
GEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTAR
IRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLF
QNLWKPRLNVP
EIF4E2 (AAH05392, 1 a.a. ~ 245 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
IgG purified
species :
Human
specificity :
EIF4E2 - eukaryotic translation initiation factor 4E member 2
gene symbol :
EIF4E2
accessionNumbers :
AAH05392
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
4EHP, 4E-LP, eIF4E type 2, eIF-4E type 2, EIF4EL3, eIF4E-like cap-binding protein, eIF4E-like protein 4E-LP, eukaryotic translation initiation factor 4E family member 2, Eukaryotic translation initiation factor 4E homologous protein, eukaryotic translation initiation factor 4E member 2, eukaryotic translation initiation factor 4E type 2, Eukaryotic translation initiation factor 4E-like 34E-LP, IF4e, mRNA cap-binding protein 4EHP, mRNA cap-binding protein type 3
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
- Peroxiredoxin 1 Antibody (4B11-D10) - Azide and BSA Free | H00005052-M01
- GSTT1 Antibody (2E10-1B2) - Azide and BSA Free | H00002952-M01
- RCC1 Antibody (2F1) - Azide and BSA Free | H00001104-M01
- RCC1 Antibody (1C1) - Azide and BSA Free | H00001104-M02
- TRAP alpha Antibody (1C11) - Azide and BSA Free | H00006745-M02
questions and comments
