product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MED21 Antibody (3E9) - Azide and BSA Free
catalog :
H00009412-M08
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3.00E+09
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
H00009412-M08
SKU :
H00009412-M08
product name :
MED21 Antibody (3E9) - Azide and BSA Free
unit size :
0.1 mg
description :
The MED21 Antibody (3E9) - Azide and BSA Free from Novus is a mouse monoclonal antibody to MED21. This antibody reacts with human. The MED21 Antibody (3E9) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
MED21
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
3.00E+09
conjugate :
Unconjugated
host :
Mouse
immunogen :
MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQ
TAINKDQPANPTEEYAQLFAALIARTAKDIDVLIDSLPS
EESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEK
IQSALADIAQSQLKTRSGTHSQSLPDS
SURB7 (AAH08380, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
TAINKDQPANPTEEYAQLFAALIARTAKDIDVLIDSLPS
EESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEK
IQSALADIAQSQLKTRSGTHSQSLPDS
SURB7 (AAH08380, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human
specificity :
SURB7 (3E9)
gene symbol :
MED21
accessionNumbers :
AAH08380
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
hSrb7, mediator complex subunit 21SRB7 (suppressor of RNA polymerase B, yeast) homolog, RNA polymerase II complex component SRB7, RNA polymerase II holoenzyme component SRB7, RNAPII complex component SRB7, SRB7 suppressor of RNA polymerase B homolog, SRB7SRB7 suppressor of RNA polymerase B homolog (yeast), SURB7mediator of RNA polymerase II transcription subunit 21
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
