product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Claudin-1 Antibody (1C5-D9) - Azide and BSA Free
catalog :
H00009076-M01
quantity :
0.1 mg
price :
519 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C5-D9
reactivity :
human, mouse
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, flow cytometry, immunohistochemistry - paraffin section
more info or order :
Novus Biologicals product webpage
citations: 23
Reference
Yamamoto D, Kayamori K, Sakamoto K, Tsuchiya M, Ikeda T, Harada H, et al. Intracellular claudin-1 at the invasive front of tongue squamous cell carcinoma is associated with lymph node metastasis. Cancer Sci. 2020;111:700-712 pubmed publisher
Sekhar V, Pollicino T, Diaz G, Engle R, Alayli F, Melis M, et al. Infection with hepatitis C virus depends on TACSTD2, a regulator of claudin-1 and occludin highly downregulated in hepatocellular carcinoma. PLoS Pathog. 2018;14:e1006916 pubmed publisher
Schöbel A, Rösch K, Herker E. Functional innate immunity restricts Hepatitis C Virus infection in induced pluripotent stem cell-derived hepatocytes. Sci Rep. 2018;8:3893 pubmed publisher
Volz P, Schilrreff P, Brodwolf R, Wolff C, Stellmacher J, Balke J, et al. Pitfalls in using fluorescence tagging of nanomaterials: tecto-dendrimers in skin tissue as investigated by Cluster-FLIM. Ann N Y Acad Sci. 2017;1405:202-214 pubmed publisher
Strüver K, Friess W, Hedtrich S. Development of a Perfusion Platform for Dynamic Cultivation of in vitro Skin Models. Skin Pharmacol Physiol. 2017;30:180-189 pubmed publisher
Giugliano S, Petroff M, Warren B, Jasti S, Linscheid C, Ward A, et al. Hepatitis C Virus Sensing by Human Trophoblasts Induces Innate Immune Responses and Recruitment of Maternal NK Cells: Potential Implications for Limiting Vertical Transmission. J Immunol. 2015;195:3737-47 pubmed publisher
Miki Y, Hamada K, Yoshino T, Miyatani K, Takahashi K. Type AB thymoma is not a mixed tumor of type A and type B thymomas, but a distinct type of thymoma. Virchows Arch. 2014;464:725-34 pubmed publisher
Ratovitski E. Phospho-?Np63? regulates AQP3, ALOX12B, CASP14 and CLDN1 expression through transcription and microRNA modulation. FEBS Lett. 2013;587:3581-6 pubmed publisher
Kitazawa K, Kawasaki S, Shinomiya K, Aoi K, Matsuda A, Funaki T, et al. Establishment of a human corneal epithelial cell line lacking the functional TACSTD2 gene as an in vitro model for gelatinous drop-like dystrophy. Invest Ophthalmol Vis Sci. 2013;54:5701-11 pubmed publisher
Broussard E, Kim R, Wiley J, Marquez J, Annis J, Pritchard D, et al. Identification of putative immunologic targets for colon cancer prevention based on conserved gene upregulation from preinvasive to malignant lesions. Cancer Prev Res (Phila). 2013;6:666-74 pubmed publisher
Florentin J, Aouar B, Dental C, Thumann C, Firaguay G, Gondois Rey F, et al. HCV glycoprotein E2 is a novel BDCA-2 ligand and acts as an inhibitor of IFN production by plasmacytoid dendritic cells. Blood. 2012;120:4544-51 pubmed publisher
Sainz B, Barretto N, Yu X, Corcoran P, Uprichard S. Permissiveness of human hepatoma cell lines for HCV infection. Virol J. 2012;9:30 pubmed publisher
Fletcher N, Wilson G, Murray J, Hu K, Lewis A, Reynolds G, et al. Hepatitis C virus infects the endothelial cells of the blood-brain barrier. Gastroenterology. 2012;142:634-643.e6 pubmed publisher
Kanki Y, Kohro T, Jiang S, Tsutsumi S, Mimura I, Suehiro J, et al. Epigenetically coordinated GATA2 binding is necessary for endothelium-specific endomucin expression. EMBO J. 2011;30:2582-95 pubmed publisher
Shaykhiev R, Otaki F, Bonsu P, Dang D, Teater M, Strulovici Barel Y, et al. Cigarette smoking reprograms apical junctional complex molecular architecture in the human airway epithelium in vivo. Cell Mol Life Sci. 2011;68:877-92 pubmed publisher
Nakatsukasa M, Kawasaki S, Yamasaki K, Fukuoka H, Matsuda A, Tsujikawa M, et al. Tumor-associated calcium signal transducer 2 is required for the proper subcellular localization of claudin 1 and 7: implications in the pathogenesis of gelatinous drop-like corneal dystrophy. Am J Pathol. 2010;177:1344-55 pubmed publisher
Guévin C, Lamarre A, Labonte P. Novel HCV replication mouse model using human hepatocellular carcinoma xenografts. Antiviral Res. 2009;84:14-22 pubmed publisher
Sainz B, TenCate V, Uprichard S. Three-dimensional Huh7 cell culture system for the study of Hepatitis C virus infection. Virol J. 2009;6:103 pubmed publisher
Mee C, Harris H, Farquhar M, Wilson G, Reynolds G, Davis C, et al. Polarization restricts hepatitis C virus entry into HepG2 hepatoma cells. J Virol. 2009;83:6211-21 pubmed publisher
Stamataki Z, Shannon Lowe C, Shaw J, Mutimer D, Rickinson A, Gordon J, et al. Hepatitis C virus association with peripheral blood B lymphocytes potentiates viral infection of liver-derived hepatoma cells. Blood. 2009;113:585-93 pubmed publisher
Farquhar M, Harris H, Diskar M, Jones S, Mee C, Nielsen S, et al. Protein kinase A-dependent step(s) in hepatitis C virus entry and infectivity. J Virol. 2008;82:8797-811 pubmed publisher
Harris H, Farquhar M, Mee C, Davis C, Reynolds G, Jennings A, et al. CD81 and claudin 1 coreceptor association: role in hepatitis C virus entry. J Virol. 2008;82:5007-20 pubmed publisher
Mee C, Grove J, Harris H, Hu K, Balfe P, McKeating J. Effect of cell polarization on hepatitis C virus entry. J Virol. 2008;82:461-70 pubmed
product information
master code :
H00009076-M01
SKU :
H00009076-M01
product name :
Claudin-1 Antibody (1C5-D9) - Azide and BSA Free
unit size :
0.1 mg
description :
The Claudin-1 Antibody (1C5-D9) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Claudin-1. This antibody reacts with human,monkey,mouse. The Claudin-1 Antibody (1C5-D9) - Azide and BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,Flow Cytometry,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin.
target :
Claudin-1
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1C5-D9
conjugate :
Unconjugated
host :
Mouse
immunogen :
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDN
IVTAQAMYEGLWMSCVSQSTGQIQCKVFDSLLNLSSTLQ
ATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMR
MAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVN
ARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPT
PRPYPKPAPSSGKDYV
CLDN1 (AAH12471.1, 1 a.a. ~ 211 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human,Monkey,Mouse
specificity :
CLDN1 - claudin 1
gene symbol :
CLDN1
accessionNumbers :
AAH12471
applications :
Western Blot,Immunocytochemistry/ Immunofluorescence,Flow Cytometry,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin
USD :
519 USD
alt names :
claudin 1, claudin-1, CLD1, ILVASCSenescence-associated epithelial membrane protein, SEMP1senescence-associated epithelial membrane protein 1
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
Novus Biologicals product webpage
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.