product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
p62/SQSTM1 Antibody (2C11) - Azide and BSA Free
catalog :
H00008878-M01
quantity :
0.1 mg
price :
519 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2C11
reactivity :
human, mouse, rat, bovine
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 423
Reference
Jia N, Ganesan D, Guan H, Jeong Y, Han S, Rajapaksha G, et al. Mitochondrial bioenergetics stimulates autophagy for pathological MAPT/Tau clearance in tauopathy neurons. Autophagy. 2025;21:54-79 pubmed publisher
Ji Y, Jeon Y, Lee W, Han J, Shin K, Huh J, et al. PKA regulates autophagy through lipolysis during fasting. Mol Cells. 2024;47:100149 pubmed publisher
Ross R, Guo Y, Walker R, Bergamaschi D, Shaw T, Connelly J. Biomechanical Activation of Keloid Fibroblasts Promotes Lysosomal Remodeling and Exocytosis. J Invest Dermatol. 2024;144:2730-2741 pubmed publisher
Onal G, Yal xe7 x131 n xc7 akmakl x131 G, xd6 z xe7 elik C, Boussaad I, x15e eker U, Fernandes H, et al. Variant-specific effects of GBA1 mutations on dopaminergic neuron proteostasis. J Neurochem. 2024;168:2543-2560 pubmed publisher
Mart xed nez Pizarro A, Pic xf3 S, L xf3 pez M xe1 rquez A, Rodriguez L xf3 pez C, Montalvo E, Alvarez M, et al. PAH deficient pathology in humanized c.1066-11G>A phenylketonuria mice. Hum Mol Genet. 2024;33:1074-1089 pubmed publisher
Nicolson S, Manning J, Lim Y, Jiang X, Kolze E, Dayan S, et al. The Drosophila ZNRF1/2 homologue, detour, interacts with HOPS complex and regulates autophagy. Commun Biol. 2024;7:183 pubmed publisher
Chedrewih M, Thiéry V, Gauthier A, Amin F. Incorporation of antimony-bearing mining wastes into clinker Portland raw feed: The difficulty of Sb analysis in calcium silicates. J Microsc. 2024;294:66-74 pubmed publisher
Khoo S, Wu P, Yeh K, Hsu S, Wu C. Biological and clinical significance of the AGE-RAGE axis in the aggressiveness and prognosis of prostate cancer. J Food Drug Anal. 2023;31:664-682 pubmed publisher
Ouyang X, Wani W, Benavides G, Redmann M, Vo H, van Groen T, et al. Cathepsin D overexpression in the nervous system rescues lethality and Aβ42 accumulation of cathepsin D systemic knockout in vivo. Acta Pharm Sin B. 2023;13:4172-4184 pubmed publisher
Lee B, Kim Y, Lee W, Choi H, Lee J, Kim J, et al. USP13 deubiquitinates p62/SQSTM1 to induce autophagy and Nrf2 release for activating antioxidant response genes. Free Radic Biol Med. 2023;208:820-832 pubmed publisher
Ko S, Choi J, Kim J. Bacteroides fragilis Enterotoxin Induces Autophagy through an AMPK and FoxO3-Pathway, Leading to the Inhibition of Apoptosis in Intestinal Epithelial Cells. Toxins (Basel). 2023;15: pubmed publisher
Stuard Sambhariya W, Trautmann I, Robertson D. Insulin-like growth factor binding protein-3 mediates hyperosmolar stress-induced mitophagy through the mechanistic target of rapamycin. J Biol Chem. 2023;299:105239 pubmed publisher
Zhang X, Shan G, Li N, Chen J, Ji C, Li X, et al. An autophagy-inducing stapled peptide induces mitochondria dysfunction and triggers autotic cell death in triple-negative breast cancer. Cell Death Discov. 2023;9:303 pubmed publisher
Leduc Gaudet J, Miguez K, Cefis M, Faitg J, Moamer A, Chaffer T, et al. Autophagy ablation in skeletal muscles worsens sepsis-induced muscle wasting, impairs whole-body metabolism, and decreases survival. iScience. 2023;26:107475 pubmed publisher
Tamargo G xf3 mez I, Mart xed nez Garc xed a G, Su xe1 rez M, Mayoral P, Bretones G, Astudillo A, et al. Analysis of ATG4C function in vivo. Autophagy. 2023;:1-22 pubmed publisher
Calcagnì A, Staiano L, Zampelli N, Minopoli N, Herz N, Di Tullio G, et al. Loss of the batten disease protein CLN3 leads to mis-trafficking of M6PR and defective autophagic-lysosomal reformation. Nat Commun. 2023;14:3911 pubmed publisher
Tejwani L, Jung Y, Kokubu H, Sowmithra S, Ni L, Lee C, et al. Reduction of Nemo-like kinase increases lysosome biogenesis and ameliorates TDP-43-related neurodegeneration. J Clin Invest. 2023;: pubmed publisher
Iemolo A, De Risi M, Giordano N, Torromino G, Somma C, Cavezza D, et al. Synaptic mechanisms underlying onset and progression of memory deficits caused by hippocampal and midbrain synucleinopathy. NPJ Parkinsons Dis. 2023;9:92 pubmed publisher
Yue M, Hu B, Li J, Chen R, Yuan Z, Xiao H, et al. Coronaviral ORF6 protein mediates inter-organelle contacts and modulates host cell lipid flux for virus production. EMBO J. 2023;42:e112542 pubmed publisher
Wen J, Zellner A, Braun N, Bajaj T, Gassen N, Peitz M, et al. Loss of function of FIP200 in human pluripotent stem cell-derived neurons leads to axonal pathology and hyperactivity. Transl Psychiatry. 2023;13:143 pubmed publisher
Mukhopadhyay S, Encarnaci xf3 n Rosado J, Lin E, Sohn A, Zhang H, Mancias J, et al. Autophagy supports mitochondrial metabolism through the regulation of iron homeostasis in pancreatic cancer. Sci Adv. 2023;9:eadf9284 pubmed publisher
Hagemann T, Coyne S, Levin A, Wang L, Feany M, Messing A. STAT3 Drives GFAP Accumulation and Astrocyte Pathology in a Mouse Model of Alexander Disease. Cells. 2023;12: pubmed publisher
Tan X, Cai K, Li J, Yuan Z, Chen R, Xiao H, et al. Coronavirus subverts ER-phagy by hijacking FAM134B and ATL3 into p62 condensates to facilitate viral replication. Cell Rep. 2023;42:112286 pubmed publisher
Shahin S, Lu B, Zhou Y, Xu H, Chetsawang J, Baloh R, et al. MFN1 augmentation prevents retinal degeneration in a Charcot-Marie-Tooth type 2A mouse model. iScience. 2023;26:106270 pubmed publisher
Vidyadhara D, Somayaji M, Wade N, Y xfc cel B, Zhao H, Shashaank N, et al. Dopamine transporter and synaptic vesicle sorting defects underlie auxilin-associated Parkinson's disease. Cell Rep. 2023;42:112231 pubmed publisher
Le Guerrou xe9 F, Bunker E, Rosencrans W, Nguyen J, Basar M, Werner A, et al. TNIP1 inhibits selective autophagy via bipartite interaction with LC3/GABARAP and TAX1BP1. Mol Cell. 2023;83:927-941.e8 pubmed publisher
Bensalem J, Hein L, Hassiotis S, Trim P, Proud C, Heilbronn L, et al. Modifying Dietary Protein Impacts mTOR Signaling and Brain Deposition of Amyloid β in a Knock-In Mouse Model of Alzheimer Disease. J Nutr. 2023;153:1407-1419 pubmed publisher
Southwell N, Zhao D, Sayles N, Dash J, Fujita K, D xe2 Aurelio M, et al. High fat diet ameliorates the mitochondrial cardiomyopathy of CHCHD10 mutant mice. bioRxiv. 2023;: pubmed publisher
Corenblum M, McRobbie Johnson A, Carruth E, Bernard K, Luo M, Mandarino L, et al. Parallel Neurodegenerative Phenotypes in Sporadic Parkinson's Disease Fibroblasts and Midbrain Dopamine Neurons. bioRxiv. 2023;: pubmed publisher
Qian H, Chao X, Wang S, Li Y, Jiang X, Sun Z, et al. Loss of SQSTM1/p62 Induces Obesity and Exacerbates Alcohol-Induced Liver Injury in Aged Mice. Cell Mol Gastroenterol Hepatol. 2023;15:1027-1049 pubmed publisher
S xe1 nchez Mart xed n P, Kriegenburg F, Alves L, Adam J, Elsaesser J, Babic R, et al. ULK1-mediated phosphorylation regulates the conserved role of YKT6 in autophagy. J Cell Sci. 2023;: pubmed publisher
Liu Y, Trnka M, He L, Burlingame A, Correia M. In-cell chemical crosslinking identifies hotspots for SQSTM-1/p62-IκBα interaction that underscore a critical role of p62 in limiting NF-κB activation through IκBα-stabilization. Mol Cell Proteomics. 2023;:100495 pubmed publisher
Gineste C, Simon A, Braun M, Reiss D, Laporte J. Tamoxifen improves muscle structure and function of Bin1- and Dnm2-related centronuclear myopathies. Brain. 2023;146:3029-3048 pubmed publisher
Miller K, Wagner M, Jassey A, Jackson W. SNAP23 is essential for germination of EV-D68 replication organelles. Virology. 2023;578:117-127 pubmed publisher
Latimer C, Melief E, Ariza Torres J, Howard K, Keen A, Keene L, et al. Protocol for the Systematic Fixation, Circuit-Based Sampling, and Qualitative and Quantitative Neuropathological Analysis of Human Brain Tissue. Methods Mol Biol. 2023;2561:3-30 pubmed publisher
Qu W, Jeong A, Zhong R, Thieschafer J, Gram A, Li L. Deletion of Small GTPase H-Ras Rescues Memory Deficits and Reduces Amyloid Plaque-Associated Dendritic Spine Loss in Transgenic Alzheimer's Mice. Mol Neurobiol. 2023;60:495-511 pubmed publisher
Akwa Y, Di Malta C, Zallo F, Gondard E, Lunati A, Diaz de Grenu L, et al. Stimulation of synaptic activity promotes TFEB-mediated clearance of pathological MAPT/Tau in cellular and mouse models of tauopathies. Autophagy. 2023;19:660-677 pubmed publisher
Huang H, Ouyang Q, Mei K, Liu T, Sun Q, Liu W, et al. Acetylation of SCFD1 regulates SNARE complex formation and autophagosome-lysosome fusion. Autophagy. 2023;19:189-203 pubmed publisher
Lee E, Jung Y, Park Y, Lim S, Choi Y, Lee S, et al. A distinct astrocyte subtype in the aging mouse brain characterized by impaired protein homeostasis. Nat Aging. 2022;2:726-741 pubmed publisher
Guo L, Reed K, Carter A, Cheng Y, Roodsari S, Martinez Pineda D, et al. Sleep-Disturbance-Induced Microglial Activation Involves CRH-Mediated Galectin 3 and Autophagy Dysregulation. Cells. 2022;12: pubmed publisher
Inoue M, Noguchi S, Inoue Y, Iida A, Ogawa M, Bengoechea R, et al. Distinctive chaperonopathy in skeletal muscle associated with the dominant variant in DNAJB4. Acta Neuropathol. 2022;: pubmed publisher
Maharjan Y, Dutta R, Son J, Wei X, Park C, Kwon H, et al. Intracellular cholesterol transport inhibition Impairs autophagy flux by decreasing autophagosome-lysosome fusion. Cell Commun Signal. 2022;20:189 pubmed publisher
Chen J, Zhang X, Gao S, Li N, Keng V, Zhao Y. A Beclin 1-targeting stapled peptide synergizes with erlotinib to potently inhibit proliferation of non-small-cell lung cancer cells. Biochem Biophys Res Commun. 2022;636:125-131 pubmed publisher
Park S, Jeon P, Yamasaki A, Lee H, Choi H, Mun J, et al. Development of new tools to study membrane-anchored mammalian Atg8 proteins. Autophagy. 2022;:1-20 pubmed publisher
Kim Y, Ko B, Kim D, Tak J, Han C, Cho J, et al. Induction of the hepatic aryl hydrocarbon receptor by alcohol dysregulates autophagy and phospholipid metabolism via PPP2R2D. Nat Commun. 2022;13:6080 pubmed publisher
Navarro Romero A, Fernandez Gonzalez I, Riera J, Montpeyo M, Albert Bayo M, López Royo T, et al. Lysosomal lipid alterations caused by glucocerebrosidase deficiency promote lysosomal dysfunction, chaperone-mediated-autophagy deficiency, and alpha-synuclein pathology. NPJ Parkinsons Dis. 2022;8:126 pubmed publisher
Ahola S, Rivera Mej xed as P, Hermans S, Chandragiri S, Giavalisco P, Nolte H, et al. OMA1-mediated integrated stress response protects against ferroptosis in mitochondrial cardiomyopathy. Cell Metab. 2022;34:1875-1891.e7 pubmed publisher
Baytas O, Kauer J, Morrow E. Loss of mitochondrial enzyme GPT2 causes early neurodegeneration in locus coeruleus. Neurobiol Dis. 2022;173:105831 pubmed publisher
Trelford C, Di Guglielmo G. Prolonged proteasome inhibition antagonizes TGFβ1-dependent signalling by promoting the lysosomal-targeting of TGFβ receptors. Cell Signal. 2022;98:110414 pubmed publisher
Silva Rojas R, P xe9 rez Gu xe0 rdia L, Lafabrie E, Moulaert D, Laporte J, B xf6 hm J. Silencing of the Ca2+ Channel ORAI1 Improves the Multi-Systemic Phenotype of Tubular Aggregate Myopathy (TAM) and Stormorken Syndrome (STRMK) in Mice. Int J Mol Sci. 2022;23: pubmed publisher
Kravic B, Bionda T, Siebert A, Gahlot P, Levantovsky S, Behrends C, et al. Ubiquitin profiling of lysophagy identifies actin stabilizer CNN2 as a target of VCP/p97 and uncovers a link to HSPB1. Mol Cell. 2022;: pubmed publisher
Yang S, Liu T, Hu C, Li W, Meng Y, Li H, et al. Ginsenoside Compound K Protects against Obesity through Pharmacological Targeting of Glucocorticoid Receptor to Activate Lipophagy and Lipid Metabolism. Pharmaceutics. 2022;14: pubmed publisher
Jung K, Oh S. The role of autophagy in cadmium-induced acute toxicity in glomerular mesangial cells and tracking polyubiquitination of cytoplasmic p53 as a biomarker. Exp Mol Med. 2022;54:685-696 pubmed publisher
Demirbag Sarikaya S, Akkoç Y, Turgut S, Erbil Bilir S, Kocaturk N, Dengjel J, et al. A novel ATG5 interaction with Ku70 potentiates DNA repair upon genotoxic stress. Sci Rep. 2022;12:8134 pubmed publisher
Xiao X, Chung P, Xu M, Hu A, Ju Y, Yang X, et al. A racemosin B derivative, C25, suppresses breast cancer growth via lysosomal membrane permeabilization and inhibition of autophagic flux. Biochem Pharmacol. 2022;201:115060 pubmed publisher
Shahin S, Xu H, Lu B, Mercado A, Jones M, Bakondi B, et al. AAV-CRISPR/Cas9 Gene Editing Preserves Long-Term Vision in the P23H Rat Model of Autosomal Dominant Retinitis Pigmentosa. Pharmaceutics. 2022;14: pubmed publisher
Del Giudice R, Imbimbo P, Pietrocola F, Martins I, De Palma F, Bravo San Pedro J, et al. Autophagy Alteration in ApoA-I Related Systemic Amyloidosis. Int J Mol Sci. 2022;23: pubmed publisher
Xiong X, Hasani S, Young L, Rivas D, Skaggs A, Martinez R, et al. Activation of Drp1 promotes fatty acids-induced metabolic reprograming to potentiate Wnt signaling in colon cancer. Cell Death Differ. 2022;: pubmed publisher
Leung Z, Abu Rafea B, Watson A, Betts D. Free fatty acid treatment of mouse preimplantation embryos demonstrates contrasting effects of palmitic acid and oleic acid on autophagy. Am J Physiol Cell Physiol. 2022;322:C833-C848 pubmed publisher
Huynh V, Benavides G, Johnson M, Ouyang X, Chacko B, Osuma E, et al. Acute inhibition of OGA sex-dependently alters the networks associated with bioenergetics, autophagy, and neurodegeneration. Mol Brain. 2022;15:22 pubmed publisher
Vessey K, Jobling A, Tran M, Wang A, Greferath U, Fletcher E. Treatments targeting autophagy ameliorate the age-related macular degeneration phenotype in mice lacking APOE (apolipoprotein E). Autophagy. 2022;18:2368-2384 pubmed publisher
Lee D, Park J, Lee Y, Bae S. PERK prevents hepatic lipotoxicity by activating the p62-ULK1 axis-mediated noncanonical KEAP1-Nrf2 pathway. Redox Biol. 2022;50:102235 pubmed publisher
Nah J, Shirakabe A, Mukai R, Zhai P, Sung E, Ivessa A, et al. Ulk1-dependent alternative mitophagy plays a protective role during pressure overload in the heart. Cardiovasc Res. 2022;118:2638-2651 pubmed publisher
Vankrunkelsven W, Derde S, Gunst J, Vander Perre S, Declerck E, Pauwels L, et al. Obesity attenuates inflammation, protein catabolism, dyslipidaemia, and muscle weakness during sepsis, independent of leptin. J Cachexia Sarcopenia Muscle. 2022;13:418-433 pubmed publisher
Tan Q, Chen J, Gao G, Yizhang -, Chen X, Yu Y, et al. Adenovirus vector encoding TPPII ignites HBV-specific CTL response by activating autophagy in CD8+ T cell. J Viral Hepat. 2022;29:178-188 pubmed publisher
Chao X, Wang S, Hlobik M, Ballabio A, Ni H, Ding W. Loss of Hepatic Transcription Factor EB Attenuates Alcohol-Associated Liver Carcinogenesis. Am J Pathol. 2022;192:87-103 pubmed publisher
Wang S, Chao X, Jiang X, Wang T, Rodriguez Y, Yang L, et al. Loss of acinar cell VMP1 triggers spontaneous pancreatitis in mice. Autophagy. 2022;18:1572-1582 pubmed publisher
Millarte V, Schlienger S, Kälin S, Spiess M. Rabaptin5 targets autophagy to damaged endosomes and Salmonella vacuoles via FIP200 and ATG16L1. EMBO Rep. 2022;23:e53429 pubmed publisher
Alves L, Marques A, Padr xe3 o N, Carvalho F, Ramalho J, Lopes C, et al. Cholesteryl hemiazelate causes lysosome dysfunction impacting vascular smooth muscle cell homeostasis. J Cell Sci. 2022;135: pubmed publisher
Yakhine Diop S, Rodr xed guez Arribas M, Canales Cort xe9 s S, Mart xed nez Chac xf3 n G, Uribe Carretero E, Blanco Ben xed tez M, et al. The parkinsonian LRRK2 R1441G mutation shows macroautophagy-mitophagy dysregulation concomitant with endoplasmic reticulum stress. Cell Biol Toxicol. 2022;38:889-911 pubmed publisher
McKinney J, Seferovic M, Major A, Suter M, Tardif S, Patterson J, et al. Placental Autophagy and Viral Replication Co-localize in Human and Non-human Primate Placentae Following Zika Virus Infection: Implications for Therapeutic Interventions. Front Virol. 2021;1: pubmed publisher
Tang Y, Wang L, Yi T, Xu J, Wang J, Qin J, et al. Synergistic effects of autophagy/mitophagy inhibitors and magnolol promote apoptosis and antitumor efficacy. Acta Pharm Sin B. 2021;11:3966-3982 pubmed publisher
Qian H, Bai Q, Yang X, Akakpo J, Ji L, Yang L, et al. Dual roles of p62/SQSTM1 in the injury and recovery phases of acetaminophen-induced liver injury in mice. Acta Pharm Sin B. 2021;11:3791-3805 pubmed publisher
Weisheit S, Wegner C, Ailte I, Radulovic M, Weyergang A, Selbo P, et al. Inhibiting autophagy increases the efficacy of low-dose photodynamic therapy. Biochem Pharmacol. 2021;194:114837 pubmed publisher
Blaudin de Thé F, Lassus B, Schaler A, Fowler S, Goulbourne C, Jeggo R, et al. P62 accumulates through neuroanatomical circuits in response to tauopathy propagation. Acta Neuropathol Commun. 2021;9:177 pubmed publisher
Peng Z, Zhao C, Du X, Yang Y, Li Y, Song Y, et al. Autophagy Induced by Palmitic Acid Regulates Neutrophil Adhesion Through the Granule-Dependent Degradation of αMβ2 Integrin in Dairy Cows With Fatty Liver. Front Immunol. 2021;12:726829 pubmed publisher
Cheng Y, Kim W, Wellman L, Sanford L, Guo M. Short-Term Sleep Fragmentation Dysregulates Autophagy in a Brain Region-Specific Manner. Life (Basel). 2021;11: pubmed publisher
Heikkinen T, Bragge T, Kuosmanen J, Parkkari T, Gustafsson S, Kwan M, et al. Global Rhes knockout in the Q175 Huntington's disease mouse model. PLoS ONE. 2021;16:e0258486 pubmed publisher
Beyer A, NORWOOD TORO L, Hughes W, Young M, Clough A, Gao F, et al. Autophagy, TERT, and mitochondrial dysfunction in hyperoxia. Am J Physiol Heart Circ Physiol. 2021;321:H985-H1003 pubmed publisher
Sun H, Ni H, McCracken J, Akakpo J, Fulte S, McKeen T, et al. Liver-specific deletion of mechanistic target of rapamycin does not protect against acetaminophen-induced liver injury in mice. Liver Res. 2021;5:79-87 pubmed publisher
Pelaz S, Ollauri Ib xe1 xf1 ez C, Lillo C, Tabernero A. Impairment of Autophagic Flux Participates in the Antitumor Effects of TAT-Cx43266-283 in Glioblastoma Stem Cells. Cancers (Basel). 2021;13: pubmed publisher
Shi Y, Xu S, Ngoi N, Hui Y, Ye Z. Rag GTPases suppress PRL-3 degradation and predict poor clinical diagnosis of cancer patients with low PRL-3 mRNA expression. Biochem Biophys Res Commun. 2021;576:108-116 pubmed publisher
Hamel Y, Mauvais F, Madrange M, Renard P, Lebreton C, Nemazanyy I, et al. Compromised mitochondrial quality control triggers lipin1-related rhabdomyolysis. Cell Rep Med. 2021;2:100370 pubmed publisher
Liu Y, Huang Q, Wei Z, Ma S, Woodgett J, Li M, et al. GSK-3 mediates nuclear translocation of p62/SQSTM1 in MPTP-induced mouse model of Parkinson's disease. Neurosci Lett. 2021;763:136177 pubmed publisher
Silva Rojas R, Charles A, Djeddi S, Geny B, Laporte J, Böhm J. Pathophysiological Effects of Overactive STIM1 on Murine Muscle Function and Structure. Cells. 2021;10: pubmed publisher
Bellanger D, Dziagwa C, Guimaraes C, Pinault M, Dumas J, Brisson L. Adipocytes Promote Breast Cancer Cell Survival and Migration through Autophagy Activation. Cancers (Basel). 2021;13: pubmed publisher
Dulac M, Leduc Gaudet J, Cefis M, Ayoub M, Reynaud O, Shams A, et al. Regulation of muscle and mitochondrial health by the mitochondrial fission protein Drp1 in aged mice. J Physiol. 2021;599:4045-4063 pubmed publisher
Hou K, Shen J, Yan J, Zhai C, Zhang J, Pan J, et al. Loss of TRIM21 alleviates cardiotoxicity by suppressing ferroptosis induced by the chemotherapeutic agent doxorubicin. EBioMedicine. 2021;69:103456 pubmed publisher
Anandhan A, Nguyen N, Syal A, Dreher L, Dodson M, Zhang D, et al. NRF2 Loss Accentuates Parkinsonian Pathology and Behavioral Dysfunction in Human α-Synuclein Overexpressing Mice. Aging Dis. 2021;12:964-982 pubmed publisher
Fontaine A, Bellanger D, Guibon R, Bruyere F, Brisson L, Fromont G. Lipophagy and prostate cancer: association with disease aggressiveness and proximity to periprostatic adipose tissue. J Pathol. 2021;255:166-176 pubmed publisher
Satoh K, Takemura Y, Satoh M, Ozaki K, Kubota S. Loss of FYCO1 leads to cataract formation. Sci Rep. 2021;11:13771 pubmed publisher
Benito Cuesta I, Ordo xf1 ez Gutierrez L, Wandosell F. Trehalose Reduces the Secreted Beta-Amyloid Levels in Primary Neurons Independently of Autophagy Induction. Metabolites. 2021;11: pubmed publisher
Towers C, Wodetzki D, Thorburn J, Smith K, Caino M, Thorburn A. Mitochondrial-derived vesicles compensate for loss of LC3-mediated mitophagy. Dev Cell. 2021;56:2029-2042.e5 pubmed publisher
Chen H, Williams K, Kwan E, Kapidzic M, Puckett K, Aburajab R, et al. Global proteomic analyses of human cytotrophoblast differentiation/invasion. Development. 2021;148: pubmed publisher
De Risi M, Tufano M, Alvino F, Ferraro M, Torromino G, Gigante Y, et al. Altered heparan sulfate metabolism during development triggers dopamine-dependent autistic-behaviours in models of lysosomal storage disorders. Nat Commun. 2021;12:3495 pubmed publisher
Goel K, Beatman E, Egersdorf N, Scruggs A, Cao D, Berdyshev E, et al. Sphingosine 1 Phosphate (S1P) Receptor 1 Is Decreased in Human Lung Microvascular Endothelial Cells of Smokers and Mediates S1P Effect on Autophagy. Cells. 2021;10: pubmed publisher
Wojnarowicz P, Escolano M, Huang Y, Desai B, Chin Y, Shah R, et al. Anti-tumor effects of an ID antagonist with no observed acquired resistance. NPJ Breast Cancer. 2021;7:58 pubmed publisher
Sul O, Li G, Kim J, Kim E, Choi H. 7-ketocholesterol enhances autophagy via the ROS-TFEB signaling pathway in osteoclasts. J Nutr Biochem. 2021;96:108783 pubmed publisher
Trelford C, Ng E, Campbell C, Di Guglielmo G. p62/Sequestosome 1 regulates transforming growth factor beta signaling and epithelial to mesenchymal transition in A549 cells. Cell Signal. 2021;85:110040 pubmed publisher
Liu J, Qi Y, Chao J, Sathuvalli P, Y Lee L, Li S. CREG1 promotes lysosomal biogenesis and function. Autophagy. 2021;17:4249-4265 pubmed publisher
Tamargo Gómez I, Martínez García G, Suarez M, Rey V, Fueyo A, Codina Martínez H, et al. ATG4D is the main ATG8 delipidating enzyme in mammalian cells and protects against cerebellar neurodegeneration. Cell Death Differ. 2021;: pubmed publisher
Poczobutt J, Mikosz A, Poirier C, Beatman E, Serban K, Gally F, et al. Altered Macrophage Function Associated with Crystalline Lung Inflammation in Acid Sphingomyelinase Deficiency. Am J Respir Cell Mol Biol. 2021;64:629-640 pubmed publisher
Mu Y, Maharjan Y, Kumar Dutta R, Wei X, Kim J, Son J, et al. Pharmacological inhibition of catalase induces peroxisome leakage and suppression of LPS induced inflammatory response in Raw 264.7 cell. PLoS ONE. 2021;16:e0245799 pubmed publisher
Robichaud S, Fairman G, Vijithakumar V, Mak E, Cook D, Pelletier A, et al. Identification of novel lipid droplet factors that regulate lipophagy and cholesterol efflux in macrophage foam cells. Autophagy. 2021;17:3671-3689 pubmed publisher
He L, Kennedy A, Houck S, Aleksandrov A, Quinney N, Cyr Scully A, et al. DNAJB12 and Hsp70 triage arrested intermediates of N1303K-CFTR for endoplasmic reticulum-associated autophagy. Mol Biol Cell. 2021;32:538-553 pubmed publisher
Recasens Alvarez C, Alexandre C, Kirkpatrick J, Nojima H, Huels D, Snijders A, et al. Ribosomopathy-associated mutations cause proteotoxic stress that is alleviated by TOR inhibition. Nat Cell Biol. 2021;23:127-135 pubmed publisher
Wang F, Zhang Y, Shen J, Yang B, Dai W, Yan J, et al. The Ubiquitin E3 Ligase TRIM21 Promotes Hepatocarcinogenesis by Suppressing the p62-Keap1-Nrf2 Antioxidant Pathway. Cell Mol Gastroenterol Hepatol. 2021;11:1369-1385 pubmed publisher
Nomura N, Ito C, Ooshio T, Tadokoro Y, Kohno S, Ueno M, et al. Essential role of autophagy in protecting neonatal haematopoietic stem cells from oxidative stress in a p62-independent manner. Sci Rep. 2021;11:1666 pubmed publisher
Park J, Choi H, Kim Y, Kim S, Kim Y, Gwon Y, et al. Aberrant role of ALK in tau proteinopathy through autophagosomal dysregulation. Mol Psychiatry. 2021;: pubmed publisher
Zhang S, Wang Y, Liu L, Zhang L, Ma L, Wu H, et al. Case Report of a pathologically confirmed vascular parkinsonism with early cognitive impairment and Behavioral disturbance. BMC Neurol. 2021;21:15 pubmed publisher
Dong X, Yang Y, Zou Z, Zhao Y, Ci B, Zhong L, et al. Sorting nexin 5 mediates virus-induced autophagy and immunity. Nature. 2021;589:456-461 pubmed publisher
Lee H, Oh S. Autophagy-mediated cytoplasmic accumulation of p53 leads to apoptosis through DRAM-BAX in cadmium-exposed human proximal tubular cells. Biochem Biophys Res Commun. 2021;534:128-133 pubmed publisher
Zhao Y, Zou Z, Sun D, Li Y, Sinha S, Yu L, et al. GLIPR2 is a negative regulator of autophagy and the BECN1-ATG14-containing phosphatidylinositol 3-kinase complex. Autophagy. 2020;:1-14 pubmed publisher
Sarraf S, Shah H, Kanfer G, Pickrell A, Holtzclaw L, Ward M, et al. Loss of TAX1BP1-Directed Autophagy Results in Protein Aggregate Accumulation in the Brain. Mol Cell. 2020;80:779-795.e10 pubmed publisher
Fischer T, Wang C, Padman B, Lazarou M, Youle R. STING induces LC3B lipidation onto single-membrane vesicles via the V-ATPase and ATG16L1-WD40 domain. J Cell Biol. 2020;219: pubmed publisher
Santos Galdiano M, Gonz xe1 lez Rodr xed guez P, Font Belmonte E, Ugidos I, Anuncibay Soto B, P xe9 rez Rodr xed guez D, et al. Celecoxib-Dependent Neuroprotection in a Rat Model of Transient Middle Cerebral Artery Occlusion (tMCAO) Involves Modifications in Unfolded Protein Response (UPR) and Proteasome. Mol Neurobiol. 2021;58:1404-1417 pubmed publisher
Bensalem J, Hattersley K, Hein L, Teong X, Carosi J, Hassiotis S, et al. Measurement of autophagic flux in humans: an optimized method for blood samples. Autophagy. 2020;:1-18 pubmed publisher
Jin Y, Ji Y, Song Y, Choe S, Jeon Y, Na H, et al. Depletion of Adipocyte Becn1 Leads to Lipodystrophy and Metabolic Dysregulation. Diabetes. 2021;70:182-195 pubmed publisher
Hui Heng L, Jun Sheng W, Jin Zhou L, Jia Wei S, Jiu Bing G, Zhifeng L, et al. LPS induced PCT production via TLR-4/NF-кB passway:it is the difference of G-/G+ bacteremia rats. Cytokine. 2021;137:155317 pubmed publisher
Hern xe1 ndez C xe1 ceres M, Cereceda K, Hern xe1 ndez S, Li Y, Narro C, Rivera P, et al. Palmitic acid reduces the autophagic flux in hypothalamic neurons by impairing autophagosome-lysosome fusion and endolysosomal dynamics. Mol Cell Oncol. 2020;7:1789418 pubmed publisher
Hu Y, Zhang J, Liu Q, Ke M, Li J, Suo W, et al. Torin2 inhibits the EGFR-TKI resistant Non-Small Lung Cancer cell proliferation through negative feedback regulation of Akt/mTOR signaling. J Cancer. 2020;11:5746-5757 pubmed publisher
Kongsomboonvech A, Rodríguez F, Diep A, Justice B, Castallanos B, Camejo A, et al. Naïve CD8 T cell IFNγ responses to a vacuolar antigen are regulated by an inflammasome-independent NLRP3 pathway and Toxoplasma gondii ROP5. PLoS Pathog. 2020;16:e1008327 pubmed publisher
Abokyi S, Shan S, To C, Chan H, Tse D. Autophagy Upregulation by the TFEB Inducer Trehalose Protects against Oxidative Damage and Cell Death Associated with NRF2 Inhibition in Human RPE Cells. Oxid Med Cell Longev. 2020;2020:5296341 pubmed publisher
Wu M, Lu G, Lao Y, Zhang H, Zheng D, Zheng Z, et al. Garciesculenxanthone B induces PINK1-Parkin-mediated mitophagy and prevents ischemia-reperfusion brain injury in mice. Acta Pharmacol Sin. 2021;42:199-208 pubmed publisher
An H, Ordureau A, Körner M, Paulo J, Harper J. Systematic quantitative analysis of ribosome inventory during nutrient stress. Nature. 2020;583:303-309 pubmed publisher
Dulac M, Leduc Gaudet J, Reynaud O, Ayoub M, Guérin A, Finkelchtein M, et al. Drp1 knockdown induces severe muscle atrophy and remodelling, mitochondrial dysfunction, autophagy impairment and denervation. J Physiol. 2020;: pubmed publisher
Hossain M, Marcus J, Lee J, Garcia P, Singh V, Shacka J, et al. Restoration of CTSD (cathepsin D) and lysosomal function in stroke is neuroprotective. Autophagy. 2020;:1-19 pubmed publisher
Van Dyck L, Vanhorebeek I, Wilmer A, Schrijvers A, Derese I, Mebis L, et al. Towards a fasting-mimicking diet for critically ill patients: the pilot randomized crossover ICU-FM-1 study. Crit Care. 2020;24:249 pubmed publisher
So K, Park B, Oh S. Cytoplasmic sirtuin 6 translocation mediated by p62 polyubiquitination plays a critical role in cadmium-induced kidney toxicity. Cell Biol Toxicol. 2021;37:193-207 pubmed publisher
Hwang D, Eom J, Jang J, Jeung H, Chung H, Kim J, et al. ULK1 inhibition as a targeted therapeutic strategy for FLT3-ITD-mutated acute myeloid leukemia. J Exp Clin Cancer Res. 2020;39:85 pubmed publisher
Lee T, Kim S, Kim H, Kim H, Kim C. Radiation Induces Autophagy via Histone H4 Lysine 20 Trimethylation in Non-small Cell Lung Cancer Cells. Anticancer Res. 2020;40:2537-2548 pubmed publisher
Nah J, Zhai P, Huang C, Fernández A, Mareedu S, Levine B, et al. Upregulation of Rubicon promotes autosis during myocardial ischemia/reperfusion injury. J Clin Invest. 2020;130:2978-2991 pubmed publisher
Mia S, Kane M, Latimer M, Reitz C, Sonkar R, Benavides G, et al. Differential effects of REV-ERBα/β agonism on cardiac gene expression, metabolism, and contractile function in a mouse model of circadian disruption. Am J Physiol Heart Circ Physiol. 2020;318:H1487-H1508 pubmed publisher
Ouyang X, Ahmad I, Johnson M, Redmann M, Craver J, Wani W, et al. Nuclear receptor binding factor 2 (NRBF2) is required for learning and memory. Lab Invest. 2020;100:1238-1251 pubmed publisher
Tadepalle N, Robers L, Veronese M, Zentis P, Babatz F, Brodesser S, et al. Microtubule-dependent and independent roles of spastin in lipid droplet dispersion and biogenesis. Life Sci Alliance. 2020;3: pubmed publisher
Liao K, Niu F, Hu G, Guo M, Sil S, Buch S. HIV Tat-mediated induction of autophagy regulates the disruption of ZO-1 in brain endothelial cells. Tissue Barriers. 2020;:1748983 pubmed publisher
Chung P, Gendoo D, Ghanbari Azarnier R, Liu J, Jiang Z, Tsui J, et al. Modeling germline mutations in pineoblastoma uncovers lysosome disruption-based therapy. Nat Commun. 2020;11:1825 pubmed publisher
Stathakos P, Jiménez Moreno N, Crompton L, Nistor P, Badger J, Barbuti P, et al. A monolayer hiPSC culture system for autophagy/mitophagy studies in human dopaminergic neurons. Autophagy. 2020;:1-17 pubmed publisher
Zhu Q, Jiang J, Gendron T, McAlonis Downes M, Jiang L, Taylor A, et al. Reduced C9ORF72 function exacerbates gain of toxicity from ALS/FTD-causing repeat expansion in C9orf72. Nat Neurosci. 2020;23:615-624 pubmed publisher
Towers C, Wodetzki D, Thorburn A. Autophagy-dependent cancer cells circumvent loss of the upstream regulator RB1CC1/FIP200 and loss of LC3 conjugation by similar mechanisms. Autophagy. 2020;16:1332-1340 pubmed publisher
Ormeño F, Hormazabal J, Moreno J, Riquelme F, Rios J, Criollo A, et al. Chaperone Mediated Autophagy Degrades TDP-43 Protein and Is Affected by TDP-43 Aggregation. Front Mol Neurosci. 2020;13:19 pubmed publisher
Mu Y, Maharjan Y, Dutta R, Kim H, Wei X, Kim J, et al. Dimethyloxaloylglycine induces pexophagy in a HIF-2α dependent manner involving autophagy receptor p62. Biochem Biophys Res Commun. 2020;: pubmed publisher
Benito Cuesta I, Ordóñez Gutiérrez L, Wandosell F. AMPK activation does not enhance autophagy in neurons in contrast to MTORC1 inhibition: different impact on β-amyloid clearance. Autophagy. 2020;:1-16 pubmed publisher
Pires Da Silva J, Monceaux K, Guilbert A, Gressette M, Piquereau J, Novotova M, et al. SIRT1 Protects the Heart from ER Stress-Induced Injury by Promoting eEF2K/eEF2-Dependent Autophagy. Cells. 2020;9: pubmed publisher
Wang S, Ni H, Chao X, Ma X, Kolodecik T, DE LISLE R, et al. Critical Role of TFEB-Mediated Lysosomal Biogenesis in Alcohol-Induced Pancreatitis in Mice and Humans. Cell Mol Gastroenterol Hepatol. 2020;10:59-81 pubmed publisher
Li P, Shi M, Maique J, Shaffer J, Yan S, Moe O, et al. Beclin 1/Bcl-2 complex-dependent autophagy activity modulates renal susceptibility to ischemia-reperfusion injury and mediates renoprotection by Klotho. Am J Physiol Renal Physiol. 2020;318:F772-F792 pubmed publisher
Fulgencio Covián A, Alonso Barroso E, Guenzel A, Rivera Barahona A, Ugarte M, Perez B, et al. Pathogenic implications of dysregulated miRNAs in propionic acidemia related cardiomyopathy. Transl Res. 2020;218:43-56 pubmed publisher
Lee D, Park J, Lee Y, Han J, Lee D, Kwon S, et al. SQSTM1/p62 activates NFE2L2/NRF2 via ULK1-mediated autophagic KEAP1 degradation and protects mouse liver from lipotoxicity. Autophagy. 2020;:1-25 pubmed publisher
Shi M, Maique J, Shaffer J, Davidson T, Sebti S, Fernández A, et al. The tripartite interaction of phosphate, autophagy, and αKlotho in health maintenance. FASEB J. 2020;34:3129-3150 pubmed publisher
Wu Y, Boulogne C, Carle S, Podinovskaia M, Barth H, Spang A, et al. Regulation of endo-lysosomal pathway and autophagic flux by broad-spectrum antipathogen inhibitor ABMA. FEBS J. 2020;287:3184-3199 pubmed publisher
Haruki K, Kosumi K, Hamada T, Twombly T, Väyrynen J, Kim S, et al. Association of autophagy status with amount of Fusobacterium nucleatum in colorectal cancer. J Pathol. 2020;250:397-408 pubmed publisher
Li Y, Ni H, Jaeschke H, Ding W. Chlorpromazine protects against acetaminophen-induced liver injury in mice by modulating autophagy and c-Jun N-terminal kinase activation. Liver Res. 2019;3:65-74 pubmed publisher
Uemura N, Yagi H, Uemura M, Yamakado H, Takahashi R. Limited spread of pathology within the brainstem of α-synuclein BAC transgenic mice inoculated with preformed fibrils into the gastrointestinal tract. Neurosci Lett. 2020;716:134651 pubmed publisher
Bassil F, Brown H, Pattabhiraman S, Iwasyk J, Maghames C, Meymand E, et al. Amyloid-Beta (Aβ) Plaques Promote Seeding and Spreading of Alpha-Synuclein and Tau in a Mouse Model of Lewy Body Disorders with Aβ Pathology. Neuron. 2020;105:260-275.e6 pubmed publisher
Khabir M, Aliche A, Sureau C, Blanchet M, Labonte P. HDV alters the autophagy process to promote its genome replication. J Virol. 2019;: pubmed publisher
Harder B, Peng S, Sereduk C, Sodoma A, Kitange G, Loftus J, et al. Inhibition of phosphatidylinositol 3-kinase by PX-866 suppresses temozolomide-induced autophagy and promotes apoptosis in glioblastoma cells. Mol Med. 2019;25:49 pubmed publisher
Vidal R, Wagner J, Braeuning C, Fischer C, Patrick R, Tombor L, et al. Transcriptional heterogeneity of fibroblasts is a hallmark of the aging heart. JCI Insight. 2019;4: pubmed publisher
Baron O, Grieshober D, Dias C, Fanto M. Fat cadherins in mouse models of degenerative ataxias. Sci Rep. 2019;9:16155 pubmed publisher
Park H, Gholam Zadeh M, Suh J, Choi H. Lycorine Attenuates Autophagy in Osteoclasts via an Axis of mROS/TRPML1/TFEB to Reduce LPS-Induced Bone Loss. Oxid Med Cell Longev. 2019;2019:8982147 pubmed publisher
Wang B, Xiao X, Huang F, Liu R. Syntaxin-17-Dependent Mitochondrial Dynamics is Essential for Protection Against Oxidative-Stress-Induced Apoptosis. Antioxidants (Basel). 2019;8: pubmed publisher
Shojaei S, Koleini N, Samiei E, Aghaei M, Cole L, Alizadeh J, et al. Simvastatin increases temozolomide-induced cell death by targeting the fusion of autophagosomes and lysosomes. FEBS J. 2020;287:1005-1034 pubmed publisher
Jung K, Oh S. Poly-ubiquitinated p62/SQSTM1-mediated hemeoxygenase-1 stabilization plays a critical role in cadmium-induced apoptosis of mouse monocyte Raw264.7 cells. Biochem Biophys Res Commun. 2019;519:409-414 pubmed publisher
Zahedi S, Fitzwalter B, Morin A, Grob S, DesMarais M, Nellan A, et al. Effect of early-stage autophagy inhibition in BRAFV600E autophagy-dependent brain tumor cells. Cell Death Dis. 2019;10:679 pubmed publisher
Escribano L xf3 pez I, de Mara xf1 on A, Iannantuoni F, L xf3 pez Dom xe8 nech S, Abad Jim xe9 nez Z, D xed az P, et al. The Mitochondrial Antioxidant SS-31 Modulates Oxidative Stress, Endoplasmic Reticulum Stress, and Autophagy in Type 2 Diabetes. J Clin Med. 2019;8: pubmed publisher
Jung K, Oh S. Polyubiquitination of p62/SQSTM1 is a prerequisite for Fas/CD95 aggregation to promote caspase-dependent apoptosis in cadmium-exposed mouse monocyte RAW264.7 cells. Sci Rep. 2019;9:12240 pubmed publisher
Bravo San Pedro J, Sica V, Martins I, Pol J, Loos F, Maiuri M, et al. Acyl-CoA-Binding Protein Is a Lipogenic Factor that Triggers Food Intake and Obesity. Cell Metab. 2019;30:754-767.e9 pubmed publisher
Towers C, Fitzwalter B, Regan D, Goodspeed A, Morgan M, Liu C, et al. Cancer Cells Upregulate NRF2 Signaling to Adapt to Autophagy Inhibition. Dev Cell. 2019;50:690-703.e6 pubmed publisher
Tardif N, Polia F, Tjader I, Gustafsson T, Rooyackers O. Autophagy flux in critical illness, a translational approach. Sci Rep. 2019;9:10762 pubmed publisher
Koike K, Berdyshev E, Mikosz A, Bronova I, Bronoff A, Jung J, et al. Role of Glucosylceramide in Lung Endothelial Cell Fate and Emphysema. Am J Respir Crit Care Med. 2019;200:1113-1125 pubmed publisher
Yan S, Zhou J, Chen X, Dong Z, Yin X. Diverse Consequences in Liver Injury in Mice with Different Autophagy Functional Status Treated with Alcohol. Am J Pathol. 2019;: pubmed publisher
Bravo J, Diaz P, Corvalan A, Quest A. A Novel Role for Helicobacter pylori Gamma-Glutamyltranspeptidase in Regulating Autophagy and Bacterial Internalization in Human Gastric Cells. Cancers (Basel). 2019;11: pubmed publisher
Martínez Arroyo O, Gruevska A, Victor V, Gonzalez Polo R, Yakhine Diop S, Fuentes J, et al. Mitophagy in human astrocytes treated with the antiretroviral drug Efavirenz: Lack of evidence or evidence of the lack. Antiviral Res. 2019;168:36-50 pubmed publisher
Wirth M, Zhang W, Razi M, Nyoni L, Joshi D, O Reilly N, et al. Molecular determinants regulating selective binding of autophagy adapters and receptors to ATG8 proteins. Nat Commun. 2019;10:2055 pubmed publisher
Roy B, Ahmed I, Ramalingam S, JALA V, Haribabu B, Ramamoorthy P, et al. Co-localization of autophagy-related protein p62 with cancer stem cell marker dclk1 may hamper dclk1's elimination during colon cancer development and progression. Oncotarget. 2019;10:2340-2354 pubmed publisher
Park J, Lee Y, Lee D, Bae S. Repositioning of niclosamide ethanolamine (NEN), an anthelmintic drug, for the treatment of lipotoxicity. Free Radic Biol Med. 2019;137:143-157 pubmed publisher
An H, Ordureau A, Paulo J, Shoemaker C, Denic V, Harper J. TEX264 Is an Endoplasmic Reticulum-Resident ATG8-Interacting Protein Critical for ER Remodeling during Nutrient Stress. Mol Cell. 2019;74:891-908.e10 pubmed publisher
Sica V, Bravo San Pedro J, Izzo V, Pol J, Pierredon S, Enot D, et al. Lethal Poisoning of Cancer Cells by Respiratory Chain Inhibition plus Dimethyl α-Ketoglutarate. Cell Rep. 2019;27:820-834.e9 pubmed publisher
Indrieri A, Carrella S, Romano A, Spaziano A, Marrocco E, Fernandez Vizarra E, et al. miR-181a/b downregulation exerts a protective action on mitochondrial disease models. EMBO Mol Med. 2019;11: pubmed publisher
Wang B, Maxwell B, Joo J, Gwon Y, Messing J, Mishra A, et al. ULK1 and ULK2 Regulate Stress Granule Disassembly Through Phosphorylation and Activation of VCP/p97. Mol Cell. 2019;74:742-757.e8 pubmed publisher
Zhao L, Pascual F, Bacudio L, Suchanek A, Young P, Li L, et al. Defective fatty acid oxidation in mice with muscle-specific acyl-CoA synthetase 1 deficiency increases amino acid use and impairs muscle function. J Biol Chem. 2019;294:8819-8833 pubmed publisher
Hernández Cáceres M, Toledo Valenzuela L, Díaz Castro F, Ávalos Y, Burgos P, Narro C, et al. Palmitic Acid Reduces the Autophagic Flux and Insulin Sensitivity Through the Activation of the Free Fatty Acid Receptor 1 (FFAR1) in the Hypothalamic Neuronal Cell Line N43/5. Front Endocrinol (Lausanne). 2019;10:176 pubmed publisher
D Alesio C, Bellese G, Gagliani M, Lechiara A, Dameri M, Grasselli E, et al. The chromodomain helicase CHD4 regulates ERBB2 signaling pathway and autophagy in ERBB2+ breast cancer cells. Biol Open. 2019;8: pubmed publisher
Eid N, Ito Y, Horibe A, Otsuki Y, Kondo Y. Ethanol-Induced Mitochondrial Damage in Sertoli Cells is Associated with Parkin Overexpression and Activation of Mitophagy. Cells. 2019;8: pubmed publisher
Wang X, Wu W, Gao J, Li Z, Dong B, Lin X, et al. Autophagy inhibition enhances PD-L1 expression in gastric cancer. J Exp Clin Cancer Res. 2019;38:140 pubmed publisher
De Miranda B, Fazzari M, Rocha E, Castro S, Greenamyre J. Sex Differences in Rotenone Sensitivity Reflect the Male-to-Female Ratio in Human Parkinson's Disease Incidence. Toxicol Sci. 2019;170:133-143 pubmed publisher
Park J, Lee D, Lee Y, Oh E, Bae K, Oh K, et al. Dual roles of ULK1 (unc-51 like autophagy activating kinase 1) in cytoprotection against lipotoxicity. Autophagy. 2019;:1-20 pubmed publisher
Taisne C, Lussignol M, Hernandez E, Moris A, Mouna L, Esclatine A. Human cytomegalovirus hijacks the autophagic machinery and LC3 homologs in order to optimize cytoplasmic envelopment of mature infectious particles. Sci Rep. 2019;9:4560 pubmed publisher
Vargas J, Wang C, Bunker E, Hao L, Maric D, Schiavo G, et al. Spatiotemporal Control of ULK1 Activation by NDP52 and TBK1 during Selective Autophagy. Mol Cell. 2019;74:347-362.e6 pubmed publisher
Aydinlik S, Dere E, Ulukaya E. Induction of autophagy enhances apoptotic cell death via epidermal growth factor receptor inhibition by canertinib in cervical cancer cells. Biochim Biophys Acta Gen Subj. 2019;1863:903-916 pubmed publisher
Wang H, Ni H, Chao X, Ma X, Rodriguez Y, Chavan H, et al. Double deletion of PINK1 and Parkin impairs hepatic mitophagy and exacerbates acetaminophen-induced liver injury in mice. Redox Biol. 2019;22:101148 pubmed publisher
Carmona Gutierrez D, Zimmermann A, Kainz K, Pietrocola F, Chen G, Maglioni S, et al. The flavonoid 4,4'-dimethoxychalcone promotes autophagy-dependent longevity across species. Nat Commun. 2019;10:651 pubmed publisher
Horos R, Büscher M, Kleinendorst R, Alleaume A, Tarafder A, Schwarzl T, et al. The Small Non-coding Vault RNA1-1 Acts as a Riboregulator of Autophagy. Cell. 2019;176:1054-1067.e12 pubmed publisher
Sin T, Zhu J, Zhang G, Li Y. p300 Mediates Muscle Wasting in Lewis Lung Carcinoma. Cancer Res. 2019;79:1331-1342 pubmed publisher
Feng X, Jia Y, Zhang Y, Ma F, Zhu Y, Hong X, et al. Ubiquitination of UVRAG by SMURF1 promotes autophagosome maturation and inhibits hepatocellular carcinoma growth. Autophagy. 2019;15:1130-1149 pubmed publisher
Koike K, Beatman E, Schweitzer K, Justice M, Mikosz A, Ni K, et al. Subcutaneous administration of neutralizing antibodies to endothelial monocyte-activating protein II attenuates cigarette smoke-induced lung injury in mice. Am J Physiol Lung Cell Mol Physiol. 2019;316:L558-L566 pubmed publisher
Wirth M, Tooze S. Autophagy Pathway Mapping to Elucidate the Function of Novel Autophagy Regulators Identified by High-Throughput Screening. Methods Mol Biol. 2019;1880:375-387 pubmed publisher
Stathakos P, Jiménez Moreno N, Crompton L, Nistor P, Caldwell M, Lane J. Imaging Autophagy in hiPSC-Derived Midbrain Dopaminergic Neuronal Cultures for Parkinson's Disease Research. Methods Mol Biol. 2019;1880:257-280 pubmed publisher
Forrester A, De Leonibus C, Grumati P, Fasana E, Piemontese M, Staiano L, et al. A selective ER-phagy exerts procollagen quality control via a Calnexin-FAM134B complex. EMBO J. 2019;38: pubmed publisher
Silva J, Rodrigues S, Sampaio Marques B, Gomes P, Neves Carvalho A, Dioli C, et al. Dysregulation of autophagy and stress granule-related proteins in stress-driven Tau pathology. Cell Death Differ. 2018;: pubmed publisher
Cai J, Pires K, Ferhat M, Chaurasia B, Buffolo M, Smalling R, et al. Autophagy Ablation in Adipocytes Induces Insulin Resistance and Reveals Roles for Lipid Peroxide and Nrf2 Signaling in Adipose-Liver Crosstalk. Cell Rep. 2018;25:1708-1717.e5 pubmed publisher
Rashid T, Nemazanyy I, Paolini C, Tatsuta T, Crespin P, De Villeneuve D, et al. Lipin1 deficiency causes sarcoplasmic reticulum stress and chaperone-responsive myopathy. EMBO J. 2019;38: pubmed publisher
von Eisenhart Rothe P, Grubman A, Greferath U, Fothergill L, Jobling A, Phipps J, et al. Failure of Autophagy-Lysosomal Pathways in Rod Photoreceptors Causes the Early Retinal Degeneration Phenotype Observed in Cln6nclf Mice. Invest Ophthalmol Vis Sci. 2018;59:5082-5097 pubmed publisher
Sun F, Jiang X, Wang X, Bao Y, Feng G, Liu H, et al. Vincristine ablation of Sirt2 induces cell apoptosis and mitophagy via Hsp70 acetylation in MDA-MB-231 cells. Biochem Pharmacol. 2019;162:142-153 pubmed publisher
Zhang Y, Mun S, Linares J, Ahn J, Towers C, Ji C, et al. ZZ-dependent regulation of p62/SQSTM1 in autophagy. Nat Commun. 2018;9:4373 pubmed publisher
Wei Y, Han B. Beclin1 decreases the RIPA-insoluble fraction of amyotrophic lateral sclerosis-linked SOD1 mutant via autophagy. Neurosci Lett. 2019;690:106-111 pubmed publisher
Janssen A, Katrukha E, van Straaten W, Verlhac P, Reggiori F, Kapitein L. Probing aggrephagy using chemically-induced protein aggregates. Nat Commun. 2018;9:4245 pubmed publisher
Civiletto G, Doğan S, Cerutti R, Fagiolari G, Moggio M, Lamperti C, et al. Rapamycin rescues mitochondrial myopathy via coordinated activation of autophagy and lysosomal biogenesis. EMBO Mol Med. 2018;10: pubmed publisher
Fahmy A, Khabir M, Blanchet M, Labonte P. LC3B is not recruited along with the autophagy elongation complex (ATG5-12/16L1) at HCV replication site and is dispensable for viral replication. PLoS ONE. 2018;13:e0205189 pubmed publisher
Valladares D, Utreras Mendoza Y, Campos C, Morales C, Díaz Vegas A, Contreras Ferrat A, et al. IP3 receptor blockade restores autophagy and mitochondrial function in skeletal muscle fibers of dystrophic mice. Biochim Biophys Acta Mol Basis Dis. 2018;1864:3685-3695 pubmed publisher
Mattar P, Bravo Sagua R, Tobar N, Fuentes C, Troncoso R, BREITWIESER G, et al. Autophagy mediates calcium-sensing receptor-induced TNFα production in human preadipocytes. Biochim Biophys Acta Mol Basis Dis. 2018;1864:3585-3594 pubmed publisher
Winer H, Fraiberg M, Abada A, Dadosh T, Tamim Yecheskel B, Elazar Z. Autophagy differentially regulates TNF receptor Fn14 by distinct mammalian Atg8 proteins. Nat Commun. 2018;9:3744 pubmed publisher
Ashraf N, Duarte Silva S, Shaw E, Maciel P, Paulson H, Teixeira Castro A, et al. Citalopram Reduces Aggregation of ATXN3 in a YAC Transgenic Mouse Model of Machado-Joseph Disease. Mol Neurobiol. 2019;56:3690-3701 pubmed publisher
Lin C, Chen Y, Lin C, Lee P, Lo G, Hsu C, et al. Significant predictors of overall survival in patients with hepatocellular carcinoma after surgical resection. PLoS ONE. 2018;13:e0202650 pubmed publisher
Palomo G, Granatiero V, Kawamata H, Konràd C, Kim M, Arreguin A, et al. Parkin is a disease modifier in the mutant SOD1 mouse model of ALS. EMBO Mol Med. 2018;10: pubmed publisher
Doğan S, Cerutti R, Benincá C, Brea Calvo G, Jacobs H, Zeviani M, et al. Perturbed Redox Signaling Exacerbates a Mitochondrial Myopathy. Cell Metab. 2018;28:764-775.e5 pubmed publisher
Sonigo C, Beau I, Grynberg M, Binart N. AMH prevents primordial ovarian follicle loss and fertility alteration in cyclophosphamide-treated mice. FASEB J. 2019;33:1278-1287 pubmed publisher
Ma S, Chen X, Tan Q, Dai S, Li D, Wu S, et al. An Engineered DC-Targeting Lentivector Induces Robust T Cell Responses and Inhibits HBV Replication in HBV Transgenic Mice via Upregulating T Cell Autophagy. Cell Physiol Biochem. 2018;48:1041-1059 pubmed publisher
Schweitzer G, Collier S, Chen Z, McCommis K, Pittman S, Yoshino J, et al. Loss of lipin 1-mediated phosphatidic acid phosphohydrolase activity in muscle leads to skeletal myopathy in mice. FASEB J. 2019;33:652-667 pubmed publisher
Manzella N, Santin Y, Maggiorani D, Martini H, Douin Echinard V, Passos J, et al. Monoamine oxidase-A is a novel driver of stress-induced premature senescence through inhibition of parkin-mediated mitophagy. Aging Cell. 2018;17:e12811 pubmed publisher
Chiang W, Wei Y, Kuo Y, Wei S, Zhou A, Zou Z, et al. High-Throughput Screens To Identify Autophagy Inducers That Function by Disrupting Beclin 1/Bcl-2 Binding. ACS Chem Biol. 2018;13:2247-2260 pubmed publisher
Henderson M, Peng C, Trojanowski J, Lee V. LRRK2 activity does not dramatically alter α-synuclein pathology in primary neurons. Acta Neuropathol Commun. 2018;6:45 pubmed publisher
Li Y, Chao X, Yang L, Lu Q, Li T, Ding W, et al. Impaired Fasting-Induced Adaptive Lipid Droplet Biogenesis in Liver-Specific Atg5-Deficient Mouse Liver Is Mediated by Persistent Nuclear Factor-Like 2 Activation. Am J Pathol. 2018;188:1833-1846 pubmed publisher
Saraswat Ohri S, Bankston A, Mullins S, Liu Y, Andres K, Beare J, et al. Blocking Autophagy in Oligodendrocytes Limits Functional Recovery after Spinal Cord Injury. J Neurosci. 2018;38:5900-5912 pubmed publisher
Chao X, Wang S, Zhao K, Li Y, Williams J, Li T, et al. Impaired TFEB-Mediated Lysosome Biogenesis and Autophagy Promote Chronic Ethanol-Induced Liver Injury and Steatosis in Mice. Gastroenterology. 2018;155:865-879.e12 pubmed publisher
Liu Z, Lee J, Son M, Lim J, Dutta R, Maharjan Y, et al. Ciliogenesis is reciprocally regulated by PPARA and NR1H4/FXR through controlling autophagy in vitro and in vivo. Autophagy. 2018;14:1011-1027 pubmed publisher
Lundquist M, Goncalves M, Loughran R, Possik E, Vijayaraghavan T, Yang A, et al. Phosphatidylinositol-5-Phosphate 4-Kinases Regulate Cellular Lipid Metabolism By Facilitating Autophagy. Mol Cell. 2018;70:531-544.e9 pubmed publisher
Lin K, Lin M, Hsu M, Yu Chen G, Chao Y, Tuan H, et al. Graphene oxide sensitizes cancer cells to chemotherapeutics by inducing early autophagy events, promoting nuclear trafficking and necrosis. Theranostics. 2018;8:2477-2487 pubmed publisher
Pascall J, Webb L, Eskelinen E, Innocentin S, Attaf Bouabdallah N, Butcher G. GIMAP6 is required for T cell maintenance and efficient autophagy in mice. PLoS ONE. 2018;13:e0196504 pubmed publisher
Aveic S, Pantile M, Polo P, Sidarovich V, De Mariano M, Quattrone A, et al. Autophagy inhibition improves the cytotoxic effects of receptor tyrosine kinase inhibitors. Cancer Cell Int. 2018;18:63 pubmed publisher
Gouspillou G, Godin R, Piquereau J, Picard M, Mofarrahi M, Mathew J, et al. Protective role of Parkin in skeletal muscle contractile and mitochondrial function. J Physiol. 2018;596:2565-2579 pubmed publisher
Maharjan Y, Lee J, Kwak S, Lim H, Dutta R, Liu Z, et al. Autophagy alteration prevents primary cilium disassembly in RPE1 cells. Biochem Biophys Res Commun. 2018;500:242-248 pubmed publisher
Duarte Silva S, Neves Carvalho A, Soares Cunha C, Silva J, Teixeira Castro A, Vieira R, et al. Neuroprotective Effects of Creatine in the CMVMJD135 Mouse Model of Spinocerebellar Ataxia Type 3. Mov Disord. 2018;33:815-826 pubmed publisher
Khan M, Layden B, Chakrabarti P. Inhibition of mTOR complexes protects cancer cells from glutamine starvation induced cell death by restoring Akt stability. Biochim Biophys Acta Mol Basis Dis. 2018;1864:2040-2052 pubmed publisher
Bresciani A, Spiezia M, Boggio R, Cariulo C, Nordheim A, Altobelli R, et al. Quantifying autophagy using novel LC3B and p62 TR-FRET assays. PLoS ONE. 2018;13:e0194423 pubmed publisher
Fitzwalter B, Towers C, Sullivan K, Andrysik Z, Hoh M, Ludwig M, et al. Autophagy Inhibition Mediates Apoptosis Sensitization in Cancer Therapy by Relieving FOXO3a Turnover. Dev Cell. 2018;44:555-565.e3 pubmed publisher
Thomas Jardin S, Kanchwala M, Jacob J, Merchant S, Meade R, Gahnim N, et al. Identification of an IL-1-induced gene expression pattern in AR+ PCa cells that mimics the molecular phenotype of AR- PCa cells. Prostate. 2018;78:595-606 pubmed publisher
Yamada S, Takashina Y, Watanabe M, Nagamine R, Saito Y, Kamada N, et al. Bile acid metabolism regulated by the gut microbiota promotes non-alcoholic steatohepatitis-associated hepatocellular carcinoma in mice. Oncotarget. 2018;9:9925-9939 pubmed publisher
Dodson M, Liu P, Jiang T, Ambrose A, Luo G, Rojo de la Vega M, et al. Increased O-GlcNAcylation of SNAP29 Drives Arsenic-Induced Autophagic Dysfunction. Mol Cell Biol. 2018;38: pubmed publisher
Bermejo Millo J, Guimarães M, de Luxán Delgado B, Potes Y, Pérez Martínez Z, Díaz Luis A, et al. High-Fructose Consumption Impairs the Redox System and Protein Quality Control in the Brain of Syrian Hamsters: Therapeutic Effects of Melatonin. Mol Neurobiol. 2018;55:7973-7986 pubmed publisher
Ordóñez Gutiérrez L, Benito Cuesta I, Abad J, Casas J, Fabrias G, Wandosell F. Dihydroceramide Desaturase 1 Inhibitors Reduce Amyloid-β Levels in Primary Neurons from an Alzheimer's Disease Transgenic Model. Pharm Res. 2018;35:49 pubmed publisher
Brewer R, Collins H, Berry R, Brahma M, Tirado B, Peliciari Garcia R, et al. Temporal partitioning of adaptive responses of the murine heart to fasting. Life Sci. 2018;197:30-39 pubmed publisher
Dodson M, de la Vega M, Harder B, Castro Portuguez R, Rodrigues S, Wong P, et al. Low-level arsenic causes proteotoxic stress and not oxidative stress. Toxicol Appl Pharmacol. 2018;341:106-113 pubmed publisher
Koukourakis M, Giatromanolaki A, Fylaktakidou K, Sivridis E, Zois C, Kalamida D, et al. SMER28 is a mTOR-independent small molecule enhancer of autophagy that protects mouse bone marrow and liver against radiotherapy. Invest New Drugs. 2018;36:773-781 pubmed publisher
Gstrein T, Edwards A, Přistoupilová A, Leca I, Breuss M, Pilat Carotta S, et al. Mutations in Vps15 perturb neuronal migration in mice and are associated with neurodevelopmental disease in humans. Nat Neurosci. 2018;21:207-217 pubmed publisher
Koukourakis M, Giatromanolaki A, Fylaktakidou K, Kouroupi M, Sivridis E, Zois C, et al. Amifostine Protects Mouse Liver Against Radiation-induced Autophagy Blockage. Anticancer Res. 2018;38:227-238 pubmed
An H, Harper J. Systematic analysis of ribophagy in human cells reveals bystander flux during selective autophagy. Nat Cell Biol. 2018;20:135-143 pubmed publisher
Balbi T, Cortese K, Ciacci C, Bellese G, Vezzulli L, Pruzzo C, et al. Autophagic processes in Mytilus galloprovincialis hemocytes: Effects of Vibrio tapetis. Fish Shellfish Immunol. 2018;73:66-74 pubmed publisher
Cevatemre B, Erkisa M, Aztopal N, Karakas D, Alper P, Tsimplouli C, et al. A promising natural product, pristimerin, results in cytotoxicity against breast cancer stem cells in vitro and xenografts in vivo through apoptosis and an incomplete autopaghy in breast cancer. Pharmacol Res. 2018;129:500-514 pubmed publisher
Lin C, Lin C, Lee P, Lo G, Hsieh P, Koh K, et al. The autophagy marker LC3 strongly predicts immediate mortality after surgical resection for hepatocellular carcinoma. Oncotarget. 2017;8:91902-91913 pubmed publisher
Baron O, Boudi A, Dias C, Schilling M, Nölle A, Vizcay Barrena G, et al. Stall in Canonical Autophagy-Lysosome Pathways Prompts Nucleophagy-Based Nuclear Breakdown in Neurodegeneration. Curr Biol. 2017;27:3626-3642.e6 pubmed publisher
Rubio González A, Bermejo Millo J, de Luxán Delgado B, Potes Y, Pérez Martínez Z, Boga J, et al. Melatonin Prevents the Harmful Effects of Obesity on the Brain, Including at the Behavioral Level. Mol Neurobiol. 2018;55:5830-5846 pubmed publisher
Thiessen S, Derese I, Derde S, Dufour T, Pauwels L, Bekhuis Y, et al. The Role of Autophagy in Critical Illness-induced Liver Damage. Sci Rep. 2017;7:14150 pubmed publisher
Merrill N, Schipper J, Karnes J, Kauffman A, Martin K, Mackeigan J. PI3K-C2? knockdown decreases autophagy and maturation of endocytic vesicles. PLoS ONE. 2017;12:e0184909 pubmed publisher
Bartolomeo R, Cinque L, De Leonibus C, Forrester A, Salzano A, Monfregola J, et al. mTORC1 hyperactivation arrests bone growth in lysosomal storage disorders by suppressing autophagy. J Clin Invest. 2017;127:3717-3729 pubmed publisher
Oh H, Chung S. Activation of transient receptor potential melastatin 7 (TRPM7) channel increases basal autophagy and reduces amyloid ?-peptide. Biochem Biophys Res Commun. 2017;493:494-499 pubmed publisher
Tuncer S, Banerjee S. Determination of Autophagy in the Caco-2 Spontaneously Differentiating Model of Intestinal Epithelial Cells. Methods Mol Biol. 2019;1854:55-70 pubmed publisher
Zhang X, Wu W, Xu W, Man K, Wang X, Han J, et al. C-X-C Motif Chemokine 10 Impairs Autophagy and Autolysosome Formation in Non-alcoholic Steatohepatitis. Theranostics. 2017;7:2822-2836 pubmed publisher
Rocchi A, Yamamoto S, Ting T, Fan Y, SADLEIR K, Wang Y, et al. A Becn1 mutation mediates hyperactive autophagic sequestration of amyloid oligomers and improved cognition in Alzheimer's disease. PLoS Genet. 2017;13:e1006962 pubmed publisher
Liang F, Li T, Azuelos I, Giordano C, Liang H, Hussain S, et al. Ventilator-induced diaphragmatic dysfunction in MDX mice. Muscle Nerve. 2018;57:442-448 pubmed publisher
García Sanz P, Orgaz L, Bueno Gil G, Espadas I, Rodríguez Traver E, Kulisevsky J, et al. N370S-GBA1 mutation causes lysosomal cholesterol accumulation in Parkinson's disease. Mov Disord. 2017;32:1409-1422 pubmed publisher
Benítez B, Sands M. Primary fibroblasts from CSPα mutation carriers recapitulate hallmarks of the adult onset neuronal ceroid lipofuscinosis. Sci Rep. 2017;7:6332 pubmed publisher
McGinnis G, Tang Y, Brewer R, Brahma M, Stanley H, Shanmugam G, et al. Genetic disruption of the cardiomyocyte circadian clock differentially influences insulin-mediated processes in the heart. J Mol Cell Cardiol. 2017;110:80-95 pubmed publisher
Santarino I, Viegas M, Domingues N, Ribeiro A, Soares M, Vieira O. Involvement of the p62/NRF2 signal transduction pathway on erythrophagocytosis. Sci Rep. 2017;7:5812 pubmed publisher
Wani W, Ouyang X, Benavides G, Redmann M, Cofield S, Shacka J, et al. O-GlcNAc regulation of autophagy and α-synuclein homeostasis; implications for Parkinson's disease. Mol Brain. 2017;10:32 pubmed publisher
Joachim J, Razi M, Judith D, Wirth M, Calamita E, Encheva V, et al. Centriolar Satellites Control GABARAP Ubiquitination and GABARAP-Mediated Autophagy. Curr Biol. 2017;27:2123-2136.e7 pubmed publisher
Willy J, Young S, Mosley A, Gawrieh S, Stevens J, Masuoka H, et al. Function of inhibitor of Bruton's tyrosine kinase isoform ? (IBTK?) in nonalcoholic steatohepatitis links autophagy and the unfolded protein response. J Biol Chem. 2017;292:14050-14065 pubmed publisher
Ko S, Jeon J, Myung H, Kim Y, Kim J. Bacteroides fragilis Enterotoxin Induces Formation of Autophagosomes in Endothelial Cells but Interferes with Fusion with Lysosomes for Complete Autophagic Flux through a Mitogen-Activated Protein Kinase-, AP-1-, and C/EBP Homologous Protein-Dependen. Infect Immun. 2017;85: pubmed publisher
Tsai T, Chen E, Li L, Saha P, Lee H, Huang L, et al. The constitutive lipid droplet protein PLIN2 regulates autophagy in liver. Autophagy. 2017;13:1130-1144 pubmed publisher
Henderson M, Chung C, Riddle D, Zhang B, Gathagan R, Seeholzer S, et al. Unbiased Proteomics of Early Lewy Body Formation Model Implicates Active Microtubule Affinity-Regulating Kinases (MARKs) in Synucleinopathies. J Neurosci. 2017;37:5870-5884 pubmed publisher
Horibe A, Eid N, Ito Y, Hamaoka H, Tanaka Y, Kondo Y. Upregulated Autophagy in Sertoli Cells of Ethanol-Treated Rats Is Associated with Induction of Inducible Nitric Oxide Synthase (iNOS), Androgen Receptor Suppression and Germ Cell Apoptosis. Int J Mol Sci. 2017;18: pubmed publisher
Schnettger L, Rodgers A, Repnik U, Lai R, Pei G, Verdoes M, et al. A Rab20-Dependent Membrane Trafficking Pathway Controls M. tuberculosis Replication by Regulating Phagosome Spaciousness and Integrity. Cell Host Microbe. 2017;21:619-628.e5 pubmed publisher
Orcholski M, Khurshudyan A, Shamskhou E, Yuan K, Chen I, Kodani S, et al. Reduced carboxylesterase 1 is associated with endothelial injury in methamphetamine-induced pulmonary arterial hypertension. Am J Physiol Lung Cell Mol Physiol. 2017;313:L252-L266 pubmed publisher
Covell D, Robinson J, Akhtar R, Grossman M, Weintraub D, Bucklin H, et al. Novel conformation-selective alpha-synuclein antibodies raised against different in vitro fibril forms show distinct patterns of Lewy pathology in Parkinson's disease. Neuropathol Appl Neurobiol. 2017;43:604-620 pubmed publisher
Zhang Y, Nguyen D, Olzomer E, Poon G, Cole N, Puvanendran A, et al. Rescue of Pink1 Deficiency by Stress-Dependent Activation of Autophagy. Cell Chem Biol. 2017;24:471-480.e4 pubmed publisher
Rodriguez Arribas M, Yakhine Diop S, Gonzalez Polo R, Niso Santano M, Fuentes J. Turnover of Lipidated LC3 and Autophagic Cargoes in Mammalian Cells. Methods Enzymol. 2017;587:55-70 pubmed publisher
Panayotopoulou E, Müller A, Börries M, Busch H, Hu G, Lev S. Targeting of apoptotic pathways by SMAC or BH3 mimetics distinctly sensitizes paclitaxel-resistant triple negative breast cancer cells. Oncotarget. 2017;8:45088-45104 pubmed publisher
Lee E, Porta S, Michael Baer G, Xu Y, Suh E, Kwong L, et al. Expansion of the classification of FTLD-TDP: distinct pathology associated with rapidly progressive frontotemporal degeneration. Acta Neuropathol. 2017;134:65-78 pubmed publisher
Redmann M, Wani W, Volpicelli Daley L, Darley Usmar V, Zhang J. Trehalose does not improve neuronal survival on exposure to alpha-synuclein pre-formed fibrils. Redox Biol. 2017;11:429-437 pubmed publisher
Ma X, Zhang S, He L, Rong Y, Brier L, Sun Q, et al. MTORC1-mediated NRBF2 phosphorylation functions as a switch for the class III PtdIns3K and autophagy. Autophagy. 2017;13:592-607 pubmed publisher
Haldar A, Piro A, Finethy R, Espenschied S, Brown H, Giebel A, et al. Chlamydia trachomatis Is Resistant to Inclusion Ubiquitination and Associated Host Defense in Gamma Interferon-Primed Human Epithelial Cells. MBio. 2016;7: pubmed publisher
Redmann M, Benavides G, Berryhill T, Wani W, Ouyang X, Johnson M, et al. Inhibition of autophagy with bafilomycin and chloroquine decreases mitochondrial quality and bioenergetic function in primary neurons. Redox Biol. 2017;11:73-81 pubmed publisher
Sambri I, D Alessio R, Ezhova Y, Giuliano T, Sorrentino N, Cacace V, et al. Lysosomal dysfunction disrupts presynaptic maintenance and restoration of presynaptic function prevents neurodegeneration in lysosomal storage diseases. EMBO Mol Med. 2017;9:112-132 pubmed publisher
Aydinlik S, Erkisa M, Cevatemre B, Sarimahmut M, Dere E, Ari F, et al. Enhanced cytotoxic activity of doxorubicin through the inhibition of autophagy in triple negative breast cancer cell line. Biochim Biophys Acta Gen Subj. 2017;1861:49-57 pubmed publisher
Fan Y, Wang N, Rocchi A, Zhang W, Vassar R, Zhou Y, et al. Identification of natural products with neuronal and metabolic benefits through autophagy induction. Autophagy. 2017;13:41-56 pubmed publisher
Zhou Y, Li Y, Ni H, Ding W, Zhong H. Nrf2 but not autophagy inhibition is associated with the survival of wild-type epidermal growth factor receptor non-small cell lung cancer cells. Toxicol Appl Pharmacol. 2016;310:140-149 pubmed publisher
Kwon J, Willy J, Quirin K, Wek R, Korc M, Yin X, et al. Novel role of miR-29a in pancreatic cancer autophagy and its therapeutic potential. Oncotarget. 2016;7:71635-71650 pubmed publisher
Conlon D, Thomas T, Fedotova T, Hernandez Ono A, Di Paolo G, Chan R, et al. Inhibition of apolipoprotein B synthesis stimulates endoplasmic reticulum autophagy that prevents steatosis. J Clin Invest. 2016;126:3852-3867 pubmed publisher
Gong J, Belinsky G, Sagheer U, Zhang X, Grippo P, Chung C. Pigment Epithelium-derived Factor (PEDF) Blocks Wnt3a Protein-induced Autophagy in Pancreatic Intraepithelial Neoplasms. J Biol Chem. 2016;291:22074-22085 pubmed
Wilson C, Nikolic A, Kentish S, Shalini S, Hatzinikolas G, Page A, et al. Sex-specific alterations in glucose homeostasis and metabolic parameters during ageing of caspase-2-deficient mice. Cell Death Discov. 2016;2:16009 pubmed publisher
Jin H, Hong S, Park J, Chang Y, Hong Y, Park I, et al. Inhibition of JNK-mediated autophagy enhances NSCLC cell sensitivity to mTORC1/2 inhibitors. Sci Rep. 2016;6:28945 pubmed publisher
Morgan M, Thorburn A. Measuring Autophagy in the Context of Cancer. Adv Exp Med Biol. 2016;899:121-43 pubmed publisher
Kuramoto K, Wang N, Fan Y, Zhang W, Schoenen F, Frankowski K, et al. Autophagy activation by novel inducers prevents BECN2-mediated drug tolerance to cannabinoids. Autophagy. 2016;12:1460-71 pubmed publisher
Li Y, McGreal S, Zhao J, Huang R, Zhou Y, Zhong H, et al. A cell-based quantitative high-throughput image screening identified novel autophagy modulators. Pharmacol Res. 2016;110:35-49 pubmed publisher
Seiferling D, Szczepanowska K, Becker C, Senft K, Hermans S, Maiti P, et al. Loss of CLPP alleviates mitochondrial cardiomyopathy without affecting the mammalian UPRmt. EMBO Rep. 2016;17:953-64 pubmed publisher
de Luxán Delgado B, Potes Y, Rubio González A, Caballero B, Solano J, Fernández Fernández M, et al. Melatonin reduces endoplasmic reticulum stress and autophagy in liver of leptin-deficient mice. J Pineal Res. 2016;61:108-23 pubmed publisher
He L, Hamm J, Reddy A, Sams D, Peliciari Garcia R, McGinnis G, et al. Biotinylation: a novel posttranslational modification linking cell autonomous circadian clocks with metabolism. Am J Physiol Heart Circ Physiol. 2016;310:H1520-32 pubmed publisher
Winner L, Beard H, Hassiotis S, Lau A, Luck A, Hopwood J, et al. A Preclinical Study Evaluating AAVrh10-Based Gene Therapy for Sanfilippo Syndrome. Hum Gene Ther. 2016;27:363-75 pubmed publisher
Yeo S, Itahana Y, Guo A, Han R, Iwamoto K, Nguyen H, et al. Transglutaminase 2 contributes to a TP53-induced autophagy program to prevent oncogenic transformation. elife. 2016;5:e07101 pubmed publisher
Sydow A, Hochgräfe K, Könen S, Cadinu D, Matenia D, Petrova O, et al. Age-dependent neuroinflammation and cognitive decline in a novel Ala152Thr-Tau transgenic mouse model of PSP and AD. Acta Neuropathol Commun. 2016;4:17 pubmed publisher
Garofalo M, Iovine B, Kuryk L, Capasso C, Hirvinen M, Vitale A, et al. Oncolytic Adenovirus Loaded with L-carnosine as Novel Strategy to Enhance the Antitumor Activity. Mol Cancer Ther. 2016;15:651-60 pubmed publisher
Korwitz A, Merkwirth C, Richter Dennerlein R, Tröder S, Sprenger H, Quirós P, et al. Loss of OMA1 delays neurodegeneration by preventing stress-induced OPA1 processing in mitochondria. J Cell Biol. 2016;212:157-66 pubmed publisher
Puvirajesinghe T, Bertucci F, Jain A, Scerbo P, Belotti E, Audebert S, et al. Identification of p62/SQSTM1 as a component of non-canonical Wnt VANGL2-JNK signalling in breast cancer. Nat Commun. 2016;7:10318 pubmed publisher
Mouna L, Hernandez E, Bonte D, Brost R, Amazit L, Delgui L, et al. Analysis of the role of autophagy inhibition by two complementary human cytomegalovirus BECN1/Beclin 1-binding proteins. Autophagy. 2016;12:327-42 pubmed publisher
Cinque L, Forrester A, Bartolomeo R, Svelto M, Venditti R, Montefusco S, et al. FGF signalling regulates bone growth through autophagy. Nature. 2015;528:272-5 pubmed publisher
Jacomin A, Bescond A, Soleilhac E, Gallet B, Schoehn G, Fauvarque M, et al. The Deubiquitinating Enzyme UBPY Is Required for Lysosomal Biogenesis and Productive Autophagy in Drosophila. PLoS ONE. 2015;10:e0143078 pubmed publisher
Dou Z, Xu C, Donahue G, Shimi T, Pan J, Zhu J, et al. Autophagy mediates degradation of nuclear lamina. Nature. 2015;527:105-9 pubmed publisher
Walker A, Tripathy K, Restrepo C, Ge G, Xu Y, Kwong L, et al. An insoluble frontotemporal lobar degeneration-associated TDP-43 C-terminal fragment causes neurodegeneration and hippocampus pathology in transgenic mice. Hum Mol Genet. 2015;24:7241-54 pubmed publisher
Nemazanyy I, Montagnac G, Russell R, Morzyglod L, Burnol A, Guan K, et al. Class III PI3K regulates organismal glucose homeostasis by providing negative feedback on hepatic insulin signalling. Nat Commun. 2015;6:8283 pubmed publisher
Lapash Daniels C, Paffenroth E, Austin E, Glebov K, Lewis D, Walter J, et al. Lithium Decreases Glial Fibrillary Acidic Protein in a Mouse Model of Alexander Disease. PLoS ONE. 2015;10:e0138132 pubmed publisher
Williams J, Ni H, Ding Y, Ding W. Parkin regulates mitophagy and mitochondrial function to protect against alcohol-induced liver injury and steatosis in mice. Am J Physiol Gastrointest Liver Physiol. 2015;309:G324-40 pubmed publisher
Yang H, Peng Y, Ni H, Li Y, Shi Y, Ding W, et al. Basal Autophagy and Feedback Activation of Akt Are Associated with Resistance to Metformin-Induced Inhibition of Hepatic Tumor Cell Growth. PLoS ONE. 2015;10:e0130953 pubmed publisher
Bakkar N, Kousari A, Kovalik T, Li Y, Bowser R. RBM45 Modulates the Antioxidant Response in Amyotrophic Lateral Sclerosis through Interactions with KEAP1. Mol Cell Biol. 2015;35:2385-99 pubmed publisher
Jurkuvenaite A, Benavides G, Komarova S, Doran S, Johnson M, Aggarwal S, et al. Upregulation of autophagy decreases chlorine-induced mitochondrial injury and lung inflammation. Free Radic Biol Med. 2015;85:83-94 pubmed publisher
Kett L, Stiller B, Bernath M, Tasset I, Blesa J, Jackson Lewis V, et al. α-Synuclein-independent histopathological and motor deficits in mice lacking the endolysosomal Parkinsonism protein Atp13a2. J Neurosci. 2015;35:5724-42 pubmed publisher
Wilson A, Ying L, Liesa M, Segeritz C, Mills J, Shen S, et al. Emergence of a stage-dependent human liver disease signature with directed differentiation of alpha-1 antitrypsin-deficient iPS cells. Stem Cell Reports. 2015;4:873-85 pubmed publisher
Li P, Shi J, He Q, Hu Q, Wang Y, Zhang L, et al. Streptococcus pneumoniae induces autophagy through the inhibition of the PI3K-I/Akt/mTOR pathway and ROS hypergeneration in A549 cells. PLoS ONE. 2015;10:e0122753 pubmed publisher
Cheong J, Zhang F, Chua P, Bay B, Thorburn A, Virshup D. Casein kinase 1α-dependent feedback loop controls autophagy in RAS-driven cancers. J Clin Invest. 2015;125:1401-18 pubmed publisher
Porta S, Kwong L, Trojanowski J, Lee V. Drosha inclusions are new components of dipeptide-repeat protein aggregates in FTLD-TDP and ALS C9orf72 expansion cases. J Neuropathol Exp Neurol. 2015;74:380-7 pubmed publisher
Pedro J, Wei Y, Sica V, Maiuri M, Zou Z, Kroemer G, et al. BAX and BAK1 are dispensable for ABT-737-induced dissociation of the BCL2-BECN1 complex and autophagy. Autophagy. 2015;11:452-9 pubmed publisher
Niso Santano M, Malik S, Pietrocola F, Bravo San Pedro J, Mariño G, Cianfanelli V, et al. Unsaturated fatty acids induce non-canonical autophagy. EMBO J. 2015;34:1025-41 pubmed publisher
Ni H, Bhakta A, Wang S, Li Z, Manley S, Huang H, et al. Role of hypoxia inducing factor-1β in alcohol-induced autophagy, steatosis and liver injury in mice. PLoS ONE. 2014;9:e115849 pubmed publisher
Shalini S, Puccini J, Wilson C, Finnie J, Dorstyn L, Kumar S. Caspase-2 protects against oxidative stress in vivo. Oncogene. 2015;34:4995-5002 pubmed publisher
Chen G, Meng C, Lin K, Tuan H, Yang H, Chen C, et al. Graphene oxide as a chemosensitizer: diverted autophagic flux, enhanced nuclear import, elevated necrosis and improved antitumor effects. Biomaterials. 2015;40:12-22 pubmed publisher
Park S, Choi S, Yoo S, Son J, Jung Y. Choline dehydrogenase interacts with SQSTM1/p62 to recruit LC3 and stimulate mitophagy. Autophagy. 2014;10:1906-20 pubmed publisher
Lin P, Duann P, Komazaki S, Park K, Li H, Sun M, et al. Lysosomal two-pore channel subtype 2 (TPC2) regulates skeletal muscle autophagic signaling. J Biol Chem. 2015;290:3377-89 pubmed publisher
Manley S, Ni H, Williams J, Kong B, DiTacchio L, Guo G, et al. Farnesoid X receptor regulates forkhead Box O3a activation in ethanol-induced autophagy and hepatotoxicity. Redox Biol. 2014;2:991-1002 pubmed publisher
Wu Q, Liu M, Huang C, Liu X, Huang B, Li N, et al. Pathogenic Ubqln2 gains toxic properties to induce neuron death. Acta Neuropathol. 2015;129:417-28 pubmed publisher
Kucukgul C, Ozler S, Inci I, Karakas E, Irmak S, Gozuacik D, et al. 3D bioprinting of biomimetic aortic vascular constructs with self-supporting cells. Biotechnol Bioeng. 2015;112:811-21 pubmed publisher
Fawzi A, Simonett J, Purta P, Moss H, Lowry J, Deng H, et al. Clinicopathologic report of ocular involvement in ALS patients with C9orf72 mutation. Amyotroph Lateral Scler Frontotemporal Degener. 2014;15:569-80 pubmed publisher
Liang N, Zhang C, Dill P, Panasyuk G, Pion D, Koka V, et al. Regulation of YAP by mTOR and autophagy reveals a therapeutic target of tuberous sclerosis complex. J Exp Med. 2014;211:2249-63 pubmed publisher
Morgan M, Gamez G, Menke C, Hernandez A, Thorburn J, Gidan F, et al. Regulation of autophagy and chloroquine sensitivity by oncogenic RAS in vitro is context-dependent. Autophagy. 2014;10:1814-26 pubmed publisher
Chang M, Patel V, Gwede M, Morgado M, Tomasevich K, Fong E, et al. IL-1? induces p62/SQSTM1 and represses androgen receptor expression in prostate cancer cells. J Cell Biochem. 2014;115:2188-97 pubmed publisher
Karanasios E, Stapleton E, Manifava M, Ktistakis N. Imaging autophagy. Curr Protoc Cytom. 2014;69:12.34.1-12.34.16 pubmed publisher
Bharath L, Mueller R, Li Y, Ruan T, Kunz D, Goodrich R, et al. Impairment of autophagy in endothelial cells prevents shear-stress-induced increases in nitric oxide bioavailability. Can J Physiol Pharmacol. 2014;92:605-12 pubmed publisher
Boyer Guittaut M, Poillet L, Liang Q, Bole Richard E, Ouyang X, Benavides G, et al. The role of GABARAPL1/GEC1 in autophagic flux and mitochondrial quality control in MDA-MB-436 breast cancer cells. Autophagy. 2014;10:986-1003 pubmed publisher
Alves S, Cormier Dequaire F, Marinello M, Marais T, Muriel M, Beaumatin F, et al. The autophagy/lysosome pathway is impaired in SCA7 patients and SCA7 knock-in mice. Acta Neuropathol. 2014;128:705-22 pubmed publisher
Mancias J, Wang X, Gygi S, Harper J, Kimmelman A. Quantitative proteomics identifies NCOA4 as the cargo receptor mediating ferritinophagy. Nature. 2014;509:105-9 pubmed publisher
B chir W, Chaveroux C, Carraro V, Averous J, Maurin A, Jousse C, et al. Dual role for CHOP in the crosstalk between autophagy and apoptosis to determine cell fate in response to amino acid deprivation. Cell Signal. 2014;26:1385-91 pubmed publisher
Macvicar T, Lane J. Impaired OMA1-dependent cleavage of OPA1 and reduced DRP1 fission activity combine to prevent mitophagy in cells that are dependent on oxidative phosphorylation. J Cell Sci. 2014;127:2313-25 pubmed publisher
Liu K, Shi Y, Guo X, Ouyang Y, Wang S, Liu D, et al. Phosphorylated AKT inhibits the apoptosis induced by DRAM-mediated mitophagy in hepatocellular carcinoma by preventing the translocation of DRAM to mitochondria. Cell Death Dis. 2014;5:e1078 pubmed publisher
Aguirre A, López Alonso I, Gonzalez Lopez A, Amado Rodríguez L, Batalla Solís E, Astudillo A, et al. Defective autophagy impairs ATF3 activity and worsens lung injury during endotoxemia. J Mol Med (Berl). 2014;92:665-76 pubmed publisher
Kulbe J, Mulcahy Levy J, Coultrap S, Thorburn A, Bayer K. Excitotoxic glutamate insults block autophagic flux in hippocampal neurons. Brain Res. 2014;1542:12-9 pubmed
Hermans G, Casaer M, Clerckx B, Guiza F, Vanhullebusch T, Derde S, et al. Effect of tolerating macronutrient deficit on the development of intensive-care unit acquired weakness: a subanalysis of the EPaNIC trial. Lancet Respir Med. 2013;1:621-629 pubmed publisher
Jones S, Cunningham D, Rappoport J, Heath J. The non-receptor tyrosine kinase Ack1 regulates the fate of activated EGFR by inducing trafficking to the p62/NBR1 pre-autophagosome. J Cell Sci. 2014;127:994-1006 pubmed publisher
Korkmaz G, Tekirdag K, Ozturk D, Kosar A, Sezerman O, Gozuacik D. MIR376A is a regulator of starvation-induced autophagy. PLoS ONE. 2013;8:e82556 pubmed publisher
Lai A, Lan C, Hasan S, Brown M, McLaurin J. scyllo-Inositol promotes robust mutant Huntingtin protein degradation. J Biol Chem. 2014;289:3666-76 pubmed publisher
Gump J, Staskiewicz L, Morgan M, Bamberg A, Riches D, Thorburn A. Autophagy variation within a cell population determines cell fate through selective degradation of Fap-1. Nat Cell Biol. 2014;16:47-54 pubmed publisher
Liu Y, Shoji Kawata S, Sumpter R, Wei Y, Ginet V, Zhang L, et al. Autosis is a Na+,K+-ATPase-regulated form of cell death triggered by autophagy-inducing peptides, starvation, and hypoxia-ischemia. Proc Natl Acad Sci U S A. 2013;110:20364-71 pubmed publisher
Manley S, Ni H, Kong B, Apte U, Guo G, Ding W. Suppression of autophagic flux by bile acids in hepatocytes. Toxicol Sci. 2014;137:478-90 pubmed publisher
Rahman M, Mofarrahi M, Kristof A, Nkengfac B, Harel S, Hussain S. Reactive oxygen species regulation of autophagy in skeletal muscles. Antioxid Redox Signal. 2014;20:443-59 pubmed publisher
Li L, Wang Z, Hill J, Lin F. New autophagy reporter mice reveal dynamics of proximal tubular autophagy. J Am Soc Nephrol. 2014;25:305-15 pubmed publisher
Allen G, Toth R, James J, Ganley I. Loss of iron triggers PINK1/Parkin-independent mitophagy. EMBO Rep. 2013;14:1127-35 pubmed publisher
Mizielinska S, Lashley T, Norona F, Clayton E, Ridler C, Fratta P, et al. C9orf72 frontotemporal lobar degeneration is characterised by frequent neuronal sense and antisense RNA foci. Acta Neuropathol. 2013;126:845-57 pubmed publisher
Chua J, Reddy S, Merry D, Adachi H, Katsuno M, Sobue G, et al. Transcriptional activation of TFEB/ZKSCAN3 target genes underlies enhanced autophagy in spinobulbar muscular atrophy. Hum Mol Genet. 2014;23:1376-86 pubmed publisher
Nah J, Pyo J, Jung S, Yoo S, Kam T, Chang J, et al. BECN1/Beclin 1 is recruited into lipid rafts by prion to activate autophagy in response to amyloid β 42. Autophagy. 2013;9:2009-21 pubmed
Dodson M, Liang Q, Johnson M, Redmann M, Fineberg N, Darley Usmar V, et al. Inhibition of glycolysis attenuates 4-hydroxynonenal-dependent autophagy and exacerbates apoptosis in differentiated SH-SY5Y neuroblastoma cells. Autophagy. 2013;9:1996-2008 pubmed
de Luxán Delgado B, Caballero B, Potes Y, Rubio González A, Rodríguez I, Gutiérrez Rodríguez J, et al. Melatonin administration decreases adipogenesis in the liver of ob/ob mice through autophagy modulation. J Pineal Res. 2014;56:126-33 pubmed publisher
Jang B, Choi B, Kim J, Kim M, Sohn M, Suh S. Impairment of autophagic flux promotes glucose reperfusion-induced neuro2A cell death after glucose deprivation. PLoS ONE. 2013;8:e76466 pubmed publisher
Chang M, Morgado M, Warren C, Hinton C, Farach Carson M, DELK N. p62/SQSTM1 is required for cell survival of apoptosis-resistant bone metastatic prostate cancer cell lines. Prostate. 2014;74:149-63 pubmed publisher
Yamano K, Youle R. PINK1 is degraded through the N-end rule pathway. Autophagy. 2013;9:1758-69 pubmed publisher
Al Khodor S, MARSHALL BATTY K, Nair V, Ding L, Greenberg D, Fraser I. Burkholderia cenocepacia J2315 escapes to the cytosol and actively subverts autophagy in human macrophages. Cell Microbiol. 2014;16:378-95 pubmed publisher
Tardif N, Klaude M, Lundell L, Thorell A, Rooyackers O. Autophagic-lysosomal pathway is the main proteolytic system modified in the skeletal muscle of esophageal cancer patients. Am J Clin Nutr. 2013;98:1485-92 pubmed publisher
Devereaux K, Dall Armi C, Alcazar Roman A, Ogasawara Y, Zhou X, Wang F, et al. Regulation of mammalian autophagy by class II and III PI 3-kinases through PI3P synthesis. PLoS ONE. 2013;8:e76405 pubmed publisher
Ni H, Du K, You M, Ding W. Critical role of FoxO3a in alcohol-induced autophagy and hepatotoxicity. Am J Pathol. 2013;183:1815-1825 pubmed publisher
Manzanillo P, Ayres J, Watson R, Collins A, Souza G, Rae C, et al. The ubiquitin ligase parkin mediates resistance to intracellular pathogens. Nature. 2013;501:512-6 pubmed publisher
Das A, Pushparaj C, Herreros J, Nager M, Vilella R, Portero M, et al. T-type calcium channel blockers inhibit autophagy and promote apoptosis of malignant melanoma cells. Pigment Cell Melanoma Res. 2013;26:874-85 pubmed publisher
Proenca C, Stoehr N, Bernhard M, Seger S, Genoud C, Roscic A, et al. Atg4b-dependent autophagic flux alleviates Huntington's disease progression. PLoS ONE. 2013;8:e68357 pubmed publisher
B chir W, Maurin A, Carraro V, Averous J, Jousse C, Muranishi Y, et al. The eIF2?/ATF4 pathway is essential for stress-induced autophagy gene expression. Nucleic Acids Res. 2013;41:7683-99 pubmed publisher
Tung Y, Wang B, Hsu W, Hu M, Her G, Huang W, et al. Presenilin-1 regulates the expression of p62 to govern p62-dependent tau degradation. Mol Neurobiol. 2014;49:10-27 pubmed publisher
Cabrera S, Fernández A, Mariño G, Aguirre A, Suarez M, Español Y, et al. ATG4B/autophagin-1 regulates intestinal homeostasis and protects mice from experimental colitis. Autophagy. 2013;9:1188-200 pubmed publisher
Liang Q, Benavides G, Vassilopoulos A, Gius D, Darley Usmar V, Zhang J. Bioenergetic and autophagic control by Sirt3 in response to nutrient deprivation in mouse embryonic fibroblasts. Biochem J. 2013;454:249-57 pubmed publisher
Sandri M, Barberi L, Bijlsma A, Blaauw B, Dyar K, Milan G, et al. Signalling pathways regulating muscle mass in ageing skeletal muscle: the role of the IGF1-Akt-mTOR-FoxO pathway. Biogerontology. 2013;14:303-23 pubmed publisher
López Alonso I, Aguirre A, Gonzalez Lopez A, Fernández A, Amado Rodríguez L, Astudillo A, et al. Impairment of autophagy decreases ventilator-induced lung injury by blockade of the NF-?B pathway. Am J Physiol Lung Cell Mol Physiol. 2013;304:L844-52 pubmed publisher
Gao L, Song J, Zhang J, Zhao X, Zhao Q, Sun K, et al. Chloroquine promotes the anticancer effect of TACE in a rabbit VX2 liver tumor model. Int J Biol Sci. 2013;9:322-30 pubmed publisher
Betin V, Singleton B, Parsons S, Anstee D, Lane J. Autophagy facilitates organelle clearance during differentiation of human erythroblasts: evidence for a role for ATG4 paralogs during autophagosome maturation. Autophagy. 2013;9:881-93 pubmed publisher
Rifki O, Bodemann B, Battiprolu P, White M, Hill J. RalGDS-dependent cardiomyocyte autophagy is required for load-induced ventricular hypertrophy. J Mol Cell Cardiol. 2013;59:128-38 pubmed publisher
Park S, Ha S, Coleman M, Meshkibaf S, Kim S. p62/SQSTM1 enhances NOD2-mediated signaling and cytokine production through stabilizing NOD2 oligomerization. PLoS ONE. 2013;8:e57138 pubmed publisher
MacCallum S, Groves M, James J, Murray K, Appleyard V, Prescott A, et al. Dysregulation of autophagy in chronic lymphocytic leukemia with the small-molecule Sirtuin inhibitor Tenovin-6. Sci Rep. 2013;3:1275 pubmed publisher
Crabtree D, Boyer Guittaut M, Ouyang X, Fineberg N, Zhang J. Dopamine and its metabolites in cathepsin D heterozygous mice before and after MPTP administration. Neurosci Lett. 2013;538:3-8 pubmed publisher
Joubert R, Vignaud A, Le M, Moal C, Messaddeq N, Buj Bello A. Site-specific Mtm1 mutagenesis by an AAV-Cre vector reveals that myotubularin is essential in adult muscle. Hum Mol Genet. 2013;22:1856-66 pubmed publisher
Mader B, Pivtoraiko V, Flippo H, Klocke B, Roth K, Mangieri L, et al. Rotenone inhibits autophagic flux prior to inducing cell death. ACS Chem Neurosci. 2012;3:1063-72 pubmed publisher
Pan J, Fan Y, Gandhirajan R, Madesh M, Zong W. Hyperactivation of the mammalian degenerin MDEG promotes caspase-8 activation and apoptosis. J Biol Chem. 2013;288:2952-63 pubmed publisher
Zeng X, Carlin C. Host cell autophagy modulates early stages of adenovirus infections in airway epithelial cells. J Virol. 2013;87:2307-19 pubmed publisher
Gan L, Vargas M, Johnson D, Johnson J. Astrocyte-specific overexpression of Nrf2 delays motor pathology and synuclein aggregation throughout the CNS in the alpha-synuclein mutant (A53T) mouse model. J Neurosci. 2012;32:17775-87 pubmed publisher
Fetalvero K, Yu Y, Goetschkes M, Liang G, Valdez R, Gould T, et al. Defective autophagy and mTORC1 signaling in myotubularin null mice. Mol Cell Biol. 2013;33:98-110 pubmed publisher
Zhang Y, Yang N, Zhou F, Shen T, Duan T, Zhou J, et al. (-)-Epigallocatechin-3-gallate induces non-apoptotic cell death in human cancer cells via ROS-mediated lysosomal membrane permeabilization. PLoS ONE. 2012;7:e46749 pubmed publisher
Liao C, Ho M, Liang S, Liang C. Recombinant protein rVP1 upregulates BECN1-independent autophagy, MAPK1/3 phosphorylation and MMP9 activity via WIPI1/WIPI2 to promote macrophage migration. Autophagy. 2013;9:5-19 pubmed publisher
Vandergaast R, Fredericksen B. West Nile virus (WNV) replication is independent of autophagy in mammalian cells. PLoS ONE. 2012;7:e45800 pubmed publisher
Williams J, Thomas A, Li G, Kong B, Zhan L, Inaba Y, et al. Tissue specific induction of p62/Sqstm1 by farnesoid X receptor. PLoS ONE. 2012;7:e43961 pubmed publisher
Kharaziha P, De Raeve H, Fristedt C, Li Q, Gruber A, Johnsson P, et al. Sorafenib has potent antitumor activity against multiple myeloma in vitro, ex vivo, and in vivo in the 5T33MM mouse model. Cancer Res. 2012;72:5348-62 pubmed publisher
Elrick M, Yu T, Chung C, Lieberman A. Impaired proteolysis underlies autophagic dysfunction in Niemann-Pick type C disease. Hum Mol Genet. 2012;21:4876-87 pubmed publisher
Cannizzo E, Clement C, Morozova K, Valdor R, Kaushik S, Almeida L, et al. Age-related oxidative stress compromises endosomal proteostasis. Cell Rep. 2012;2:136-49 pubmed publisher
Ramos F, Chen S, Garelick M, Dai D, Liao C, Schreiber K, et al. Rapamycin reverses elevated mTORC1 signaling in lamin A/C-deficient mice, rescues cardiac and skeletal muscle function, and extends survival. Sci Transl Med. 2012;4:144ra103 pubmed publisher
Lai A, McLaurin J. Inhibition of amyloid-beta peptide aggregation rescues the autophagic deficits in the TgCRND8 mouse model of Alzheimer disease. Biochim Biophys Acta. 2012;1822:1629-37 pubmed publisher
Hagemann T, Jobe E, Messing A. Genetic ablation of Nrf2/antioxidant response pathway in Alexander disease mice reduces hippocampal gliosis but does not impact survival. PLoS ONE. 2012;7:e37304 pubmed publisher
Marchbank K, Waters S, Roberts R, Solomon E, Whitehouse C. MAP1B Interaction with the FW Domain of the Autophagic Receptor Nbr1 Facilitates Its Association to the Microtubule Network. Int J Cell Biol. 2012;2012:208014 pubmed publisher
Ni H, Boggess N, McGill M, Lebofsky M, Borude P, Apte U, et al. Liver-specific loss of Atg5 causes persistent activation of Nrf2 and protects against acetaminophen-induced liver injury. Toxicol Sci. 2012;127:438-50 pubmed publisher
Menon S, Yecies J, Zhang H, Howell J, Nicholatos J, Harputlugil E, et al. Chronic activation of mTOR complex 1 is sufficient to cause hepatocellular carcinoma in mice. Sci Signal. 2012;5:ra24 pubmed publisher
Durieux A, Vassilopoulos S, Laine J, Fraysse B, Brinas L, Prudhon B, et al. A centronuclear myopathy--dynamin 2 mutation impairs autophagy in mice. Traffic. 2012;13:869-79 pubmed publisher
Ghazi Noori S, Froud K, Mizielinska S, Powell C, Smidak M, Fernández de Marco M, et al. Progressive neuronal inclusion formation and axonal degeneration in CHMP2B mutant transgenic mice. Brain. 2012;135:819-32 pubmed publisher
Jaber N, Dou Z, Chen J, Catanzaro J, Jiang Y, Ballou L, et al. Class III PI3K Vps34 plays an essential role in autophagy and in heart and liver function. Proc Natl Acad Sci U S A. 2012;109:2003-8 pubmed publisher
Kharaziha P, Rodriguez P, Li Q, Rundqvist H, Björklund A, Augsten M, et al. Targeting of distinct signaling cascades and cancer-associated fibroblasts define the efficacy of Sorafenib against prostate cancer cells. Cell Death Dis. 2012;3:e262 pubmed publisher
Chen J, Xavier S, Moskowitz Kassai E, Chen R, Lu C, Sanduski K, et al. Cathepsin cleavage of sirtuin 1 in endothelial progenitor cells mediates stress-induced premature senescence. Am J Pathol. 2012;180:973-83 pubmed publisher
Krüger U, Wang Y, Kumar S, Mandelkow E. Autophagic degradation of tau in primary neurons and its enhancement by trehalose. Neurobiol Aging. 2012;33:2291-305 pubmed publisher
Ohmi K, Zhao H, Neufeld E. Defects in the medial entorhinal cortex and dentate gyrus in the mouse model of Sanfilippo syndrome type B. PLoS ONE. 2011;6:e27461 pubmed publisher
Zois C, Giatromanolaki A, Sivridis E, Papaiakovou M, Kainulainen H, Koukourakis M. "Autophagic flux" in normal mouse tissues: focus on endogenous LC3A processing. Autophagy. 2011;7:1371-8 pubmed publisher
Deng H, Chen W, Hong S, Boycott K, Gorrie G, Siddique N, et al. Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia. Nature. 2011;477:211-5 pubmed publisher
Levy J, Thorburn A. Modulation of pediatric brain tumor autophagy and chemosensitivity. J Neurooncol. 2012;106:281-90 pubmed publisher
Kovacs J, Li C, Yang Q, Li G, Garcia I, Ju S, et al. Autophagy promotes T-cell survival through degradation of proteins of the cell death machinery. Cell Death Differ. 2012;19:144-52 pubmed publisher
Li H, Wang P, Sun Q, Ding W, Yin X, Sobol R, et al. Following cytochrome c release, autophagy is inhibited during chemotherapy-induced apoptosis by caspase 8-mediated cleavage of Beclin 1. Cancer Res. 2011;71:3625-34 pubmed publisher
Yang S, Wang X, Contino G, Liesa M, Sahin E, Ying H, et al. Pancreatic cancers require autophagy for tumor growth. Genes Dev. 2011;25:717-29 pubmed publisher
Zois C, Giatromanolaki A, Kainulainen H, Botaitis S, Torvinen S, Simopoulos C, et al. Lung autophagic response following exposure of mice to whole body irradiation, with and without amifostine. Biochem Biophys Res Commun. 2011;404:552-8 pubmed publisher
Harr M, McColl K, Zhong F, Molitoris J, Distelhorst C. Glucocorticoids downregulate Fyn and inhibit IP(3)-mediated calcium signaling to promote autophagy in T lymphocytes. Autophagy. 2010;6:912-21 pubmed publisher
Whitehouse C, Waters S, Marchbank K, Horner A, McGowan N, Jovanovic J, et al. Neighbor of Brca1 gene (Nbr1) functions as a negative regulator of postnatal osteoblastic bone formation and p38 MAPK activity. Proc Natl Acad Sci U S A. 2010;107:12913-8 pubmed publisher
Deng H, Zhai H, Bigio E, Yan J, Fecto F, Ajroud K, et al. FUS-immunoreactive inclusions are a common feature in sporadic and non-SOD1 familial amyotrophic lateral sclerosis. Ann Neurol. 2010;67:739-48 pubmed publisher
Wang B, Ling S, Lin W. 14-3-3Tau regulates Beclin 1 and is required for autophagy. PLoS ONE. 2010;5:e10409 pubmed publisher
Lee H, Mattei L, Steinberg B, Alberts P, Lee Y, Chervonsky A, et al. In vivo requirement for Atg5 in antigen presentation by dendritic cells. Immunity. 2010;32:227-39 pubmed publisher
Wu Y, Tan H, Shui G, Bauvy C, Huang Q, Wenk M, et al. Dual role of 3-methyladenine in modulation of autophagy via different temporal patterns of inhibition on class I and III phosphoinositide 3-kinase. J Biol Chem. 2010;285:10850-61 pubmed publisher
Mardakheh F, Yekezare M, Machesky L, Heath J. Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling. J Cell Biol. 2009;187:265-77 pubmed publisher
Ferguson C, Lenk G, Meisler M. Defective autophagy in neurons and astrocytes from mice deficient in PI(3,5)P2. Hum Mol Genet. 2009;18:4868-78 pubmed publisher
Gal J, Strom A, Kwinter D, Kilty R, Zhang J, Shi P, et al. Sequestosome 1/p62 links familial ALS mutant SOD1 to LC3 via an ubiquitin-independent mechanism. J Neurochem. 2009;111:1062-73 pubmed publisher
Bjørkøy G, Lamark T, Pankiv S, Øvervatn A, Brech A, Johansen T. Monitoring autophagic degradation of p62/SQSTM1. Methods Enzymol. 2009;452:181-97 pubmed publisher
Jung H, Chung K, Won Kim J, Kim J, Komatsu M, Tanaka K, et al. Loss of autophagy diminishes pancreatic beta cell mass and function with resultant hyperglycemia. Cell Metab. 2008;8:318-24 pubmed publisher
product information
master code :
H00008878-M01
SKU :
H00008878-M01
product name :
p62/SQSTM1 Antibody (2C11) - Azide and BSA Free
unit size :
0.1 mg
description :
The p62/SQSTM1 Antibody (2C11) - Azide and BSA Free from Novus is a mouse monoclonal antibody to p62/SQSTM1. This antibody reacts with bovine,hamster,human,mouse,rabbit,rat. The p62/SQSTM1 Antibody (2C11) - Azide and BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,IF/IHC,Bioassay,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunoblotting,ELISA,Immunoprecipitation.
target :
p62/SQSTM1
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
2C11
conjugate :
Unconjugated
host :
Mouse
immunogen :
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAA
GPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFS
SDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEA
PRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEG
KGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGW
PGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSV
NFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSP
ESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMR
KIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTG
ELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEA
DPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALD
TIQYSKHPPPL
SQSTM1 (AAH03139.1, 1 a.a. ~ 440 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Bovine,Hamster,Human,Mouse,Rabbit,Rat
theoretical molecular weight :
47.7 kDa
gene symbol :
SQSTM1
Antibody validation :
Knockout/Knockdown
accessionNumbers :
Q13501
applications :
Western Blot,Immunocytochemistry/ Immunofluorescence,IF/IHC,Bioassay,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunoblotting,ELISA,Immunoprecipitation
USD :
519 USD
alt names :
A170, Autophagy Receptor P62, DMRV, EBI3-associated protein of 60 kDa, EBI3-associated protein p60, EBIAP, FTDALS3, NADGP, ORCA, OSIL, oxidative stress induced like, p60PDB3, p62, p62B, Paget disease of bone 3, PDB3, phosphotyrosine independent ligand for the Lck SH2 domain p62, Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa, sequestosome 1, sequestosome-1, Ubiquitin-binding protein p62, ZIP3
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.