product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
API5 Antibody (1C2) - Azide and BSA Free
catalog :
H00008539-M01
quantity :
0.1 mg
price :
529 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C2
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
product information
master code :
H00008539-M01
SKU :
H00008539-M01
product name :
API5 Antibody (1C2) - Azide and BSA Free
unit size :
0.1 mg
description :
The API5 Antibody (1C2) - Azide and BSA Free from Novus is a mouse monoclonal antibody to API5. This antibody reacts with human. The API5 Antibody (1C2) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.
target :
API5
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1C2
conjugate :
Unconjugated
host :
Mouse
immunogen :
GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKST
VTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDA
RQIYNPPSGKYSSNLGNFNYERSLQGK
API5 (AAH17709, 400 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
VTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDA
RQIYNPPSGKYSSNLGNFNYERSLQGK
API5 (AAH17709, 400 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2b Kappa
purity :
Protein A purified
species :
Human
specificity :
API5 (1C2)
gene symbol :
API5
accessionNumbers :
AAH17709
applications :
ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
AAC-11API5L1, AAC11fibroblast growth factor 2-interacting factor 2, Antiapoptosis clone 11 protein, API-5, apoptosis inhibitor 5, Cell migration-inducing gene 8 protein, Fibroblast growth factor 2-interacting factor, FIF, migration-inducing protein MIG8, Protein XAGL
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
- GATA-2 Antibody (2D11) - Azide and BSA Free | H00002624-M01
- Septin-10 Antibody (2A12) - Azide and BSA Free | H00151011-M01
- RHOXF2 Antibody - Azide and BSA Free | H00084528-B01P
- DNAJA4 Antibody (4B4-1F2) - Azide and BSA Free | H00055466-M01
- Gelsolin/GSN Antibody (3G5) - Azide and BSA Free | H00002934-M01
questions and comments
