KLF11 Antibody (10D8) - Azide and BSA Free | Novus Biologicals H00008462-M03 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

KLF11 Antibody (10D8) - Azide and BSA Free

catalog :

H00008462-M03

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

10D8

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, chromatin immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Lin L, Pfender K, Ditsch N, Kuhn C, Rahmeh M, Peng L, et al. KLF11 is an independent negative prognostic factor for breast cancer from a cohort study and induces proliferation and inhibits apoptosis in vitro. Breast Cancer. 2023;30:758-771 pubmed publisher
Londero A, Orsaria M, Viola L, Marzinotto S, Bertozzi S, Galvano E, et al. Survivin, sonic hedgehog, krüppel-like factors, and p53 pathway in serous ovarian cancer: an immunohistochemical study. Hum Pathol. 2022;127:92-101 pubmed publisher
De Lorenzo S, Vrieze A, Johnson R, Lien K, Nath K, Garovic V, et al. KLF11 deficiency enhances chemokine generation and fibrosis in murine unilateral ureteral obstruction. PLoS ONE. 2022;17:e0266454 pubmed publisher
Tang X, Liu K, HAMBLIN M, Xu Y, Yin K. Genetic Deletion of Krüppel-Like Factor 11 Aggravates Ischemic Brain Injury. Mol Neurobiol. 2018;55:2911-2921 pubmed publisher
Mathison A, Escande C, Calvo E, Seo S, White T, Salmonson A, et al. Phenotypic Characterization of Mice Carrying Homozygous Deletion of KLF11, a Gene in Which Mutations Cause Human Neonatal and MODY VII Diabetes. Endocrinology. 2015;156:3581-95 pubmed publisher
Loft A, Forss I, SiersbÃ¦k M, Schmidt S, Larsen A, Madsen J, et al. Browning of human adipocytes requires KLF11 and reprogramming of PPARÎ³ superenhancers. Genes Dev. 2015;29:7-22 pubmed publisher
Yin K, Fan Y, Hamblin M, Zhang J, Zhu T, Li S, et al. KLF11 mediates PPAR? cerebrovascular protection in ischaemic stroke. Brain. 2013;136:1274-87 pubmed publisher

product information

master code :

H00008462-M03

SKU :

H00008462-M03

product name :

KLF11 Antibody (10D8) - Azide and BSA Free

unit size :

0.1 mg

description :

The KLF11 Antibody (10D8) - Azide and BSA Free from Novus is a mouse monoclonal antibody to KLF11. This antibody reacts with human,mouse,rat. The KLF11 Antibody (10D8) - Azide and BSA Free has been validated for the following applications: Chemotaxis,IF/IHC,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Chromatin Immunoprecipitation (ChIP).

target :

KLF11

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

10D8

conjugate :

Unconjugated

host :

Mouse

immunogen :

TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELS
RHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKK
IPGWQAEVGKLNRIASAESPGSPLVSMPASA
KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse,Rat

specificity :

KLF11 - Kruppel-like factor 11 (10D8)

gene symbol :

KLF11

accessionNumbers :

NP_003588

applications :

Chemotaxis,IF/IHC,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Chromatin Immunoprecipitation (ChIP)

USD :

529 USD

alt names :

FKLFFKLF1, Krueppel-like factor 11, Kruppel-like factor 11, MODY7TGFB-inducible early growth response protein 2, TIEG-2, TIEG2TGFB inducible early growth response 2, Tieg3, Transforming growth factor-beta-inducible early growth response protein 2

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage