product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
USP9x Antibody (1C4) - Azide and BSA Free
catalog :
H00008239-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C4
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
Novus Biologicals product webpage
citations: 11
Reference
Perurena N, Lock R, Davis R, Raghavan S, Pilla N, Ng R, et al. USP9X mediates an acute adaptive response to MAPK suppression in pancreatic cancer but creates multiple actionable therapeutic vulnerabilities. Cell Rep Med. 2023;4:101007 pubmed publisher
Hwang D, Kim M, Kim S, Kwon M, Kang Y, Kim D, et al. AMOTL2 mono-ubiquitination by WWP1 promotes contact inhibition by facilitating LATS activation. Life Sci Alliance. 2021;4: pubmed publisher
Shahriyar S, Seo S, Min K, Kubatka P, Min D, Chang J, et al. Upregulation of DR5 and Downregulation of Survivin by IITZ-01, Lysosomotropic Autophagy Inhibitor, Potentiates TRAIL-Mediated Apoptosis in Renal Cancer Cells via Ubiquitin-Proteasome Pathway. Cancers (Basel). 2020;12: pubmed publisher
Wu K, Woo S, Kwon T. The Histone Lysine-specific Demethylase 1 Inhibitor, SP2509 Exerts Cytotoxic Effects against Renal Cancer Cells through Downregulation of Bcl-2 and Mcl-1. J Cancer Prev. 2020;25:79-86 pubmed publisher
Wolfsperger F, Hogh Binder S, Schittenhelm J, Psaras T, Ritter V, Bornes L, et al. Deubiquitylating enzyme USP9x regulates radiosensitivity in glioblastoma cells by Mcl-1-dependent and -independent mechanisms. Cell Death Dis. 2016;7:e2039 pubmed publisher
Kim M, Kim M, Park S, Lee C, Lim D. Role of Angiomotin-like 2 mono-ubiquitination on YAP inhibition. EMBO Rep. 2016;17:64-78 pubmed publisher
Wang B, Xie M, Li R, Owonikoko T, Ramalingam S, Khuri F, et al. Role of Ku70 in deubiquitination of Mcl-1 and suppression of apoptosis. Cell Death Differ. 2014;21:1160-9 pubmed publisher
Trivigno D, Essmann F, Huber S, Rudner J. Deubiquitinase USP9x confers radioresistance through stabilization of Mcl-1. Neoplasia. 2012;14:893-904 pubmed
Mazumder S, Choudhary G, Al Harbi S, Almasan A. Mcl-1 Phosphorylation defines ABT-737 resistance that can be overcome by increased NOXA expression in leukemic B cells. Cancer Res. 2012;72:3069-79 pubmed publisher
Hikita H, Takehara T, Shimizu S, Kodama T, Shigekawa M, Iwase K, et al. The Bcl-xL inhibitor, ABT-737, efficiently induces apoptosis and suppresses growth of hepatoma cells in combination with sorafenib. Hepatology. 2010;52:1310-21 pubmed publisher
Schwickart M, Huang X, Lill J, Liu J, Ferrando R, French D, et al. Deubiquitinase USP9X stabilizes MCL1 and promotes tumour cell survival. Nature. 2010;463:103-7 pubmed publisher
product information
master code :
H00008239-M01
SKU :
H00008239-M01
product name :
USP9x Antibody (1C4) - Azide and BSA Free
unit size :
0.1 mg
description :
The USP9x Antibody (1C4) - Azide and BSA Free from Novus is a mouse monoclonal antibody to USP9x. This antibody reacts with human. The USP9x Antibody (1C4) - Azide and BSA Free has been validated for the following applications: Immunohistochemistry-Paraffin,Western Blot,ELISA,Immunohistochemistry,Immunoprecipitation,Immunocytochemistry/ Immunofluorescence.
target :
USP9x
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1C4
conjugate :
Unconjugated
host :
Mouse
immunogen :
MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSS
NENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDM
INRPRWVVPVLP
USP9X (NP_068706, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
IgG purified
species :
Human
specificity :
USP9X - ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila)
gene symbol :
USP9X
applications :
Western Blot,Immunohistochemistry-Paraffin,ELISA,Immunohistochemistry,Immunoprecipitation,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
Deubiquitinating enzyme FAF-X, DFFRXubiquitin specific protease 9, X-linked (fat facets-like, Drosophila), Drosophila fat facets related, X-linked, EC 3.1.2.15, EC 3.4.19.12, FAF, FAM, Fat facets in mammals, fat facets protein related, X-linked, Fat facets protein-related, X-linked, hFAM, probable ubiquitin carboxyl-terminal hydrolase FAF-X, ubiquitin specific peptidase 9, X-linked, ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila), ubiquitin thioesterase FAF-X, Ubiquitin thiolesterase FAF-X, ubiquitin-specific processing protease FAF-X, Ubiquitin-specific protease 9, X chromosome, Ubiquitin-specific-processing protease FAF-X, USP9, X chromosome (fat facets-like Drosophila)
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
Novus Biologicals product webpage
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.