Laforin/EPM2A Antibody (6C6) - Azide and BSA Free | Novus Biologicals H00007957-M02 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Laforin/EPM2A Antibody (6C6) - Azide and BSA Free

catalog :

H00007957-M02

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6C6

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunoprecipitation

more info or order :

Novus Biologicals product webpage

citations: 10

Reference
Mitra S, Chen B, Wang P, Chown E, Dear M, Guisso D, et al. Laforin targets malin to glycogen in Lafora progressive myoclonus epilepsy. Dis Model Mech. 2023;16: pubmed publisher
Liu Q, Li J, Zhang W, Xiao C, Zhang S, Nian C, et al. Glycogen accumulation and phase separation drives liver tumor initiation. Cell. 2021;184:5559-5576.e19 pubmed publisher
Irimia J, Tagliabracci V, Meyer C, Segvich D, DePaoli Roach A, Roach P. Muscle glycogen remodeling and glycogen phosphate metabolism following exhaustive exercise of wild type and laforin knockout mice. J Biol Chem. 2015;290:22686-98 pubmed publisher
Zhu Y, Zhang M, Kelly A, Cheng A. The carbohydrate-binding domain of overexpressed STBD1 is important for its stability and protein-protein interactions. Biosci Rep. 2014;34: pubmed publisher
Sherwood A, JOHNSON M, Delgado Escueta A, Gentry M. A bioassay for Lafora disease and laforin glucan phosphatase activity. Clin Biochem. 2013;46:1869-76 pubmed publisher
Turnbull J, Girard J, Lohi H, Chan E, Wang P, Tiberia E, et al. Early-onset Lafora body disease. Brain. 2012;135:2684-98 pubmed publisher
Tiberia E, Turnbull J, Wang T, Ruggieri A, Zhao X, Pencea N, et al. Increased laforin and laforin binding to glycogen underlie Lafora body formation in malin-deficient Lafora disease. J Biol Chem. 2012;287:25650-9 pubmed publisher
DePaoli Roach A, Segvich D, Meyer C, Rahimi Y, Worby C, Gentry M, et al. Laforin and malin knockout mice have normal glucose disposal and insulin sensitivity. Hum Mol Genet. 2012;21:1604-10 pubmed publisher
Turnbull J, Wang P, Girard J, Ruggieri A, Wang T, Draginov A, et al. Glycogen hyperphosphorylation underlies lafora body formation. Ann Neurol. 2010;68:925-33 pubmed publisher
Tagliabracci V, Turnbull J, Wang W, Girard J, Zhao X, Skurat A, et al. Laforin is a glycogen phosphatase, deficiency of which leads to elevated phosphorylation of glycogen in vivo. Proc Natl Acad Sci U S A. 2007;104:19262-6 pubmed

product information

master code :

H00007957-M02

SKU :

H00007957-M02

product name :

Laforin/EPM2A Antibody (6C6) - Azide and BSA Free

unit size :

0.1 mg

description :

The Laforin/EPM2A Antibody (6C6) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Laforin/EPM2A. This antibody reacts with human,mouse,rat. The Laforin/EPM2A Antibody (6C6) - Azide and BSA Free has been validated for the following applications: ELISA,Immunoprecipitation,Western Blot,Sandwich ELISA.

target :

Laforin/EPM2A

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

6C6

conjugate :

Unconjugated

host :

Mouse

immunogen :

GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEM
KHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTI
KLKHELGITAVMNFQTEWDIV
EPM2A (NP_001018051, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse,Rat

specificity :

EPM2A - epilepsy, progressive myoclonus type 2A, Lafora disease (laforin)

gene symbol :

EPM2A

accessionNumbers :

NP_001018051

applications :

ELISA,Immunoprecipitation,Western Blot,Sandwich ELISA

USD :

529 USD

alt names :

EC 3.1.3.16, EC 3.1.3.48, epilepsy, progressive myoclonus type 2, Lafora disease (laforin), epilepsy, progressive myoclonus type 2A, Lafora disease (laforin), EPM2, Lafora PTPase, laforin, LAFPTPase, LD, LDE, MELF

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage