This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ZSCAN21/ZFP38 Antibody (4B3)
catalog :
H00007589-M09
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4B3
reactivity :
human, rat
application :
western blot, ELISA
product information
brand :
Novus
master code :
H00007589-M09
SKU :
H00007589-M09
product name :
ZSCAN21/ZFP38 Antibody (4B3)
unit size :
0.1 mg
seo description :
The ZSCAN21/ZFP38 Antibody (4B3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to ZSCAN21/ZFP38. This antibody reacts with human,rat. The ZSCAN21/ZFP38 Antibody (4B3) - Azide and BSA Free has been validated for the following applications: ELISA,Western Blot.
target :
ZSCAN21/ZFP38
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
4B3
conjugate :
Unconjugated
dilution :
Western Blot, ELISA
host :
Mouse
immunogen :
MMTKVLGMAPVLGPRPPQEQVGPLMVKVEEKEEKGKYLP
SLEMFRQRFRQFGYHDTPGPREALSQLRVLCCEWLRPEI
HTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEEAV
TLLEDLERELDEPGHQVSTPPNEQKPVWEKISSSGTAKE
SPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRK
VRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIANKPE
ASLERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPG
ERRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGK
AFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQ
RMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQC
NECGKSFSQHAGLSSHQRLHTGEKPYKCKECGKAFNHSS
NFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTG
EGEAP
ZSCAN21 (AAH47309.1, 1 a.a. ~ 473 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
SLEMFRQRFRQFGYHDTPGPREALSQLRVLCCEWLRPEI
HTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEEAV
TLLEDLERELDEPGHQVSTPPNEQKPVWEKISSSGTAKE
SPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRK
VRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIANKPE
ASLERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPG
ERRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGK
AFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQ
RMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQC
NECGKSFSQHAGLSSHQRLHTGEKPYKCKECGKAFNHSS
NFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTG
EGEAP
ZSCAN21 (AAH47309.1, 1 a.a. ~ 473 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human,Rat
specificity :
ZNF38 - zinc finger protein 38
gene symbol :
ZSCAN21
accessionNumbers :
AAH47309
applications :
ELISA,Western Blot
USD :
499 USD
alt names :
DKFZp434L134, KOX25, NY-REN-21, Renal carcinoma antigen NY-REN-21, Zfp-38, ZFP38, zinc finger and SCAN domain containing 21, zinc finger and SCAN domain-containing protein 21, zinc finger protein 38, zinc finger protein 38 (KOX 25), Zinc finger protein 38 homolog, zinc finger protein NY-REN-21 antigen, Zipro1, ZNF38DKFZp686H10254
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
