product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Splicing Factor 1 Antibody (2E12) - Azide and BSA Free
catalog :
H00007536-M01
quantity :
0.1 mg
price :
529 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2.00E+12
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
product information
master code :
H00007536-M01
SKU :
H00007536-M01
product name :
Splicing Factor 1 Antibody (2E12) - Azide and BSA Free
unit size :
0.1 mg
description :
The Splicing Factor 1 Antibody (2E12) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Splicing Factor 1. This antibody reacts with human,mouse. The Splicing Factor 1 Antibody (2E12) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Splicing Factor 1
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
2.00E+12
conjugate :
Unconjugated
host :
Mouse
immunogen :
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTV
IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPED
RSPSPEPIYNSEGKRLNTREFRTRKKLEEERH
SF1 (NP_004621, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPED
RSPSPEPIYNSEGKRLNTREFRTRKKLEEERH
SF1 (NP_004621, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human,Mouse
specificity :
SF1 - splicing factor 1
gene symbol :
SF1
accessionNumbers :
NP_004621
applications :
ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
Mammalian branch point-binding protein, mBBP, splicing factor 1, Transcription factor ZFM1, ZFM1BBP, Zinc finger gene in MEN1 locus, Zinc finger protein 162D11S636, ZNF162MBBP
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
