product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
XRCC1 Antibody - Azide and BSA Free
catalog :
H00007515-B01P
quantity :
0.05 mg
price :
499 USD
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
product information
master code :
H00007515-B01P
SKU :
H00007515-B01P
product name :
XRCC1 Antibody - Azide and BSA Free
unit size :
0.05 mg
description :
The XRCC1 Antibody - Azide and BSA Free from Novus is a mouse polyclonal antibody to XRCC1. This antibody reacts with human. The XRCC1 Antibody - Azide and BSA Free has been validated for the following applications: Knockdown Validated,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
XRCC1
category :
Primary Antibodies
buffer :
PBS (pH 7.4)
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Mouse
immunogen :
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAG
EKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGG
AGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLV
RAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKD
EAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRI
NKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGS
TSKPQESPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRP
KLPAPTRTPATAPVPARAQGAVTGKPRGEGTEPRRPRAG
PEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRP
DWTRDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCH
RMRRRLPSQRYLMAGPGSSSEEDEASHSGGSGDEAPKLP
QKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDI
DIEGVQSEGQDNGAEDSGDTEDELRRVAEQKEHRLPPGQ
EENGEDPYAGSTDENTDSEEHQEPPDLPVPELPDFFQGK
HFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVI
TAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPH
QLYGVVPQA
XRCC1 (AAH23593.1, 1 a.a. - 633 a.a.) full-length human protein.
EKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGG
AGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLV
RAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKD
EAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRI
NKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGS
TSKPQESPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRP
KLPAPTRTPATAPVPARAQGAVTGKPRGEGTEPRRPRAG
PEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRP
DWTRDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCH
RMRRRLPSQRYLMAGPGSSSEEDEASHSGGSGDEAPKLP
QKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDI
DIEGVQSEGQDNGAEDSGDTEDELRRVAEQKEHRLPPGQ
EENGEDPYAGSTDENTDSEEHQEPPDLPVPELPDFFQGK
HFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVI
TAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPH
QLYGVVPQA
XRCC1 (AAH23593.1, 1 a.a. - 633 a.a.) full-length human protein.
isotype :
IgG
purity :
Protein A purified
species :
Human
specificity :
XRCC1 - X-ray repair complementing defective repair in Chinese hamster cells 1,
gene symbol :
XRCC1
accessionNumbers :
AAH23593.1
applications :
Knockdown Validated,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
499 USD
alt names :
DNA repair protein XRCC1, RCC, X-ray repair complementing defective repair in Chinese hamster cells 1, X-ray repair cross-complementing protein 1, X-ray-repair, complementing defective, repair in Chinese hamster
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
- TAX1BP3 Antibody (4A10) - Azide and BSA Free | H00030851-M01
- PLA2G4B Antibody (1G5) - Azide and BSA Free | H00008681-M01
- GRAP2 Antibody (1G12) - Azide and BSA Free | H00009402-M01
- G protein alpha inhibitor 1 Antibody (2B8-2A5) - Azide and BSA Free | H00002770-M01
- ILT6/CD85e/LILRA3 Antibody (2E9) - Azide and BSA Free | H00011026-M01
questions and comments
