product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
UBTF Antibody (6B6) - Azide and BSA Free
catalog :
H00007343-M01
quantity :
0.1 mg
price :
529 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
6B6
reactivity :
human, mouse, bovine
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
Novus Biologicals product webpage
citations: 10
Reference
Kitaoka M, Smith O, Straight A, Heald R. Molecular conflicts disrupting centromere maintenance contribute to Xenopus hybrid inviability. Curr Biol. 2022;32:3939-3951.e6 pubmed publisher
Chebrout M, Kon xe9 M, Jan H, Cournut M, Letheule M, Fleurot R, et al. Transcription of rRNA in early mouse embryos promotes chromatin reorganization and expression of major satellite repeats. J Cell Sci. 2022;135: pubmed publisher
Dannheisig D, Schimansky A, Donow C, Pfister A. Nucleolar Stress Functions Upstream to Stimulate Expression of Autophagy Regulators. Cancers (Basel). 2021;13: pubmed publisher
Koné M, Fleurot R, Chebrout M, Debey P, Beaujean N, Bonnet Garnier A. Three-Dimensional Distribution of UBF and Nopp140 in Relationship to Ribosomal DNA Transcription During Mouse Preimplantation Development. Biol Reprod. 2016;94:95 pubmed publisher
Fulka H, Langerova A. The maternal nucleolus plays a key role in centromere satellite maintenance during the oocyte to embryo transition. Development. 2014;141:1694-704 pubmed publisher
Kalt I, Levy A, Borodianskiy Shteinberg T, Sarid R. Nucleolar localization of GLTSCR2/PICT-1 is mediated by multiple unique nucleolar localization sequences. PLoS ONE. 2012;7:e30825 pubmed publisher
Zougman A, Mann M, Wisniewski J. Identification and characterization of a novel ubiquitous nucleolar protein 'NARR' encoded by a gene overlapping the rab34 oncogene. Nucleic Acids Res. 2011;39:7103-13 pubmed publisher
Østrup O, Strejcek F, Petrovicova I, Lucas Hahn A, Morovic M, Lemme E, et al. Role of ooplasm in nuclear and nucleolar remodeling of intergeneric somatic cell nuclear transfer embryos during the first cell cycle. Cell Reprogram. 2011;13:145-55 pubmed publisher
Song B, Lee S, Kim S, Kim J, Park J, Kim C, et al. Nucleologenesis and embryonic genome activation are defective in interspecies cloned embryos between bovine ooplasm and rhesus monkey somatic cells. BMC Dev Biol. 2009;9:44 pubmed publisher
Østrup O, Petrovicova I, Strejcek F, Morovic M, Lucas Hahn A, Lemme E, et al. Nuclear and nucleolar reprogramming during the first cell cycle in bovine nuclear transfer embryos. Cloning Stem Cells. 2009;11:367-75 pubmed publisher
product information
master code :
H00007343-M01
SKU :
H00007343-M01
product name :
UBTF Antibody (6B6) - Azide and BSA Free
unit size :
0.1 mg
description :
The UBTF Antibody (6B6) - Azide and BSA Free from Novus is a mouse monoclonal antibody to UBTF. This antibody reacts with bovine,human,monkey,mouse,porcine. The UBTF Antibody (6B6) - Azide and BSA Free has been validated for the following applications: Western Blot,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.
target :
UBTF
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
6B6
conjugate :
Unconjugated
host :
Mouse
immunogen :
PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELN
HLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKV
HLDLWVKSLSPQDRAAYKEYIS
UBTF (NP_055048, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Bovine,Human,Monkey,Mouse,Porcine
specificity :
UBTF - upstream binding transcription factor, RNA polymerase I
gene symbol :
UBTF
accessionNumbers :
NP_055048
applications :
Western Blot,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
90-KDa Nucleolus Organizer Region Autoantigen, Autoantigen NOR-90, NOR-90, nucleolar transcription factor 1, UBF, UBF1, UBF-1, UBF2, UBFUBF-1, upstream binding transcription factor, RNA polymerase I, Upstream-binding factor 1
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
Novus Biologicals product webpage
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.