TFF3 Antibody (3D9) | Novus Biologicals H00007033-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

TFF3 Antibody (3D9)

catalog :

H00007033-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3D9

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
Du T, Luo H, Qin H, Wang F, Wang Q, Xiang Y, et al. Circulating serum trefoil factor 3 (TFF3) is dramatically increased in chronic kidney disease. PLoS ONE. 2013;8:e80271 pubmed publisher
Han G, Sidhu D, Duggan M, Arseneau J, Cesari M, Clement P, et al. Reproducibility of histological cell type in high-grade endometrial carcinoma. Mod Pathol. 2013;26:1594-604 pubmed publisher
Casado E, García V, Sanchez J, Gómez Del Pulgar M, Feliu J, Maurel J, et al. Upregulation of trefoil factor 3 (TFF3) after rectal cancer chemoradiotherapy is an adverse prognostic factor and a potential therapeutic target. Int J Radiat Oncol Biol Phys. 2012;84:1151-8 pubmed publisher
Schulze U, Hampel U, Sel S, Goecke T, Thäle V, Garreis F, et al. Fresh and cryopreserved amniotic membrane secrete the trefoil factor family peptide 3 that is well known to promote wound healing. Histochem Cell Biol. 2012;138:243-50 pubmed publisher
Kim H, Kang U, Lee H, Jung J, Lee S, Yu M, et al. Profiling of differentially expressed proteins in stage IV colorectal cancers with good and poor outcomes. J Proteomics. 2012;75:2983-97 pubmed publisher
Proia T, Keller P, Gupta P, Klebba I, Jones A, Sedic M, et al. Genetic predisposition directs breast cancer phenotype by dictating progenitor cell fate. Cell Stem Cell. 2011;8:149-63 pubmed publisher
Kalloger S, K xf6 bel M, Leung S, Mehl E, Gao D, Marcon K, et al. Calculator for ovarian carcinoma subtype prediction. Mod Pathol. 2011;24:512-21 pubmed publisher
Xue H, Lu B, Zhang J, Wu M, Huang Q, Wu Q, et al. Identification of serum biomarkers for colorectal cancer metastasis using a differential secretome approach. J Proteome Res. 2010;9:545-55 pubmed publisher
Bignotti E, Ravaggi A, Tassi R, Calza S, Rossi E, Falchetti M, et al. Trefoil factor 3: a novel serum marker identified by gene expression profiling in high-grade endometrial carcinomas. Br J Cancer. 2008;99:768-73 pubmed publisher

product information

brand :

Novus

master code :

H00007033-M01

SKU :

H00007033-M01

product name :

TFF3 Antibody (3D9)

unit size :

0.1 mg

seo description :

The TFF3 Antibody (3D9) - Azide and BSA Free from Novus is a mouse monoclonal antibody to TFF3. This antibody reacts with human. The TFF3 Antibody (3D9) - Azide and BSA Free has been validated for the following applications: IF/IHC,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.

target :

TFF3

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3D9

conjugate :

Unconjugated

dilution :

Western Blot 1:500, ELISA, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 3 ug/ml

host :

Mouse

immunogen :

EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFD
SRIPGVPWCFKPLQEAECTF
TFF3 (AAH17859.1, 15 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human

specificity :

TFF3 - trefoil factor 3 (intestinal)

gene symbol :

TFF3

accessionNumbers :

AAH17859

applications :

ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,IF/IHC

USD :

529 USD

alt names :

HITF, human intestinal trefoil factor10Intestinal trefoil factor, trefoil factor 3 (intestinal)

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage