ZEB1 Antibody (4C4) | Novus Biologicals H00006935-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ZEB1 Antibody (4C4)

catalog :

H00006935-M01

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4C4

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Al Kharashi L, Bakheet T, AlHarbi W, Al Moghrabi N, Aboussekhra A. Eugenol modulates genomic methylation and inactivates breast cancer-associated fibroblasts through E2F1-dependent downregulation of DNMT1/DNMT3A. Mol Carcinog. 2021;60:784-795 pubmed publisher
Dong X, Han Y, Zhang E, Wang Y, Zhang P, Wang C, et al. Tumor suppressor DCAF15 inhibits epithelial-mesenchymal transition by targeting ZEB1 for proteasomal degradation in hepatocellular carcinoma. Aging (Albany NY). 2021;13:10603-10618 pubmed publisher
Cancel M, Castellier C, Debiais Delpech C, Charles T, Rozet F, Rioux Leclercq N, et al. Specificities of small cell neuroendocrine prostate cancer: Adverse prognostic value of TTF1 expression. Urol Oncol. 2021;39:74.e17-74.e23 pubmed publisher
Figiel S, Pasqualin C, Bery F, Maupoil V, Vandier C, Potier Cartereau M, et al. Functional Organotypic Cultures of Prostate Tissues: A Relevant Preclinical Model that Preserves Hypoxia Sensitivity and Calcium Signaling. Am J Pathol. 2019;189:1268-1275 pubmed publisher
Al Harbi B, Hendrayani S, Silva G, Aboussekhra A. Let-7b inhibits cancer-promoting effects of breast cancer-associated fibroblasts through IL-8 repression. Oncotarget. 2018;9:17825-17838 pubmed publisher
Al Khalaf H, Amir M, Al Mohanna F, Tulbah A, Al Sayed A, Aboussekhra A. Obesity and p16INK4A Downregulation Activate Breast Adipocytes and Promote Their Protumorigenicity. Mol Cell Biol. 2017;37: pubmed publisher
Al Khalaf H, Aboussekhra A. p16INK4A induces senescence and inhibits EMT through microRNA-141/microRNA-146b-5p-dependent repression of AUF1. Mol Carcinog. 2017;56:985-999 pubmed publisher
Hendrayani S, Al Khalaf H, Aboussekhra A. The cytokine IL-6 reactivates breast stromal fibroblasts through transcription factor STAT3-dependent up-regulation of the RNA-binding protein AUF1. J Biol Chem. 2014;289:30962-76 pubmed publisher

product information

brand :

Novus

master code :

H00006935-M01

SKU :

H00006935-M01

product name :

ZEB1 Antibody (4C4)

unit size :

0.1 mg

seo description :

The ZEB1 Antibody (4C4) - Azide and BSA Free from Novus is a mouse monoclonal antibody to ZEB1. This antibody reacts with human. The ZEB1 Antibody (4C4) - Azide and BSA Free has been validated for the following applications: Western Blot,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

ZEB1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4C4

conjugate :

Unconjugated

dilution :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin

host :

Mouse

immunogen :

NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIP
QVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGV
SNVEDQNDSDSTPPKKKMRKTE
ZEB1 (NP_110378, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human

specificity :

transcription factor 8 (represses interleukin 2 expression)

gene symbol :

ZEB1

accessionNumbers :

NP_110378

applications :

ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Western Blot

USD :

499 USD

alt names :

AREB6MGC133261, delta-crystallin enhancer binding factor 1, DELTAEF1, FECD6, Negative regulator of IL2, NIL2A, NIL-2-A, NIL-2-A zinc finger protein, posterior polymorphous corneal dystrophy 3, PPCD3, TCF-8, TCF8BZP, Transcription factor 8, transcription factor 8 (represses interleukin 2 expression), ZEB, Zfhep, ZFHX1A, zinc finger E-box binding homeobox 1, zinc finger E-box-binding homeobox 1, zinc finger homeodomain enhancer-binding protein

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage