STIM1 Antibody (5A2) | Novus Biologicals H00006786-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

STIM1 Antibody (5A2)

catalog :

H00006786-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

5A2

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

citations: 23

Reference
Lisak D, Schacht T, Gawlitza A, Albrecht P, Aktas O, Koop B, et al. BAX inhibitor-1 is a Ca(2+) channel critically important for immune cell function and survival. Cell Death Differ. 2016;23:358-68 pubmed publisher
Hong C, Chang K, Wang H, Yu H, Lee C. IL-9 induces IL-8 production via STIM1 activation and ERK phosphorylation in epidermal keratinocytes: A plausible mechanism of IL-9R in atopic dermatitis. J Dermatol Sci. 2015;78:206-14 pubmed publisher
Duquette M, Nadler M, Okuhara D, Thompson J, Shuttleworth T, Lawler J. Members of the thrombospondin gene family bind stromal interaction molecule 1 and regulate calcium channel activity. Matrix Biol. 2014;37:15-24 pubmed publisher
Ferdaus M, Xiao B, Ohara H, Nemoto K, Harada Y, Saar K, et al. Identification of Stim1 as a candidate gene for exaggerated sympathetic response to stress in the stroke-prone spontaneously hypertensive rat. PLoS ONE. 2014;9:e95091 pubmed publisher
Umemura M, Baljinnyam E, Feske S, De Lorenzo M, Xie L, Feng X, et al. Store-operated Ca2+ entry (SOCE) regulates melanoma proliferation and cell migration. PLoS ONE. 2014;9:e89292 pubmed publisher
Schmid E, Bhandaru M, Nurbaeva M, Yang W, Szteyn K, Russo A, et al. SGK3 regulates Ca(2+) entry and migration of dendritic cells. Cell Physiol Biochem. 2012;30:1423-35 pubmed publisher
Jans R, Mottram L, Johnson D, Brown A, Sikkink S, Ross K, et al. Lysophosphatidic acid promotes cell migration through STIM1- and Orai1-mediated Ca2+(i) mobilization and NFAT2 activation. J Invest Dermatol. 2013;133:793-802 pubmed publisher
Henke N, Albrecht P, Pfeiffer A, Toutzaris D, Zanger K, Methner A. Stromal interaction molecule 1 (STIM1) is involved in the regulation of mitochondrial shape and bioenergetics and plays a role in oxidative stress. J Biol Chem. 2012;287:42042-52 pubmed publisher
Elvers M, Herrmann A, Seizer P, Münzer P, Beck S, Schonberger T, et al. Intracellular cyclophilin A is an important Ca(2+) regulator in platelets and critically involved in arterial thrombus formation. Blood. 2012;120:1317-26 pubmed publisher
Eylenstein A, Schmidt S, Gu S, Yang W, Schmid E, Schmidt E, et al. Transcription factor NF-?B regulates expression of pore-forming Ca2+ channel unit, Orai1, and its activator, STIM1, to control Ca2+ entry and affect cellular functions. J Biol Chem. 2012;287:2719-30 pubmed publisher
Steinbeck J, Henke N, Opatz J, Gruszczynska Biegala J, Schneider L, Theiss S, et al. Store-operated calcium entry modulates neuronal network activity in a model of chronic epilepsy. Exp Neurol. 2011;232:185-94 pubmed publisher
Kiviluoto S, Decuypere J, De Smedt H, Missiaen L, Parys J, Bultynck G. STIM1 as a key regulator for Ca2+ homeostasis in skeletal-muscle development and function. Skelet Muscle. 2011;1:16 pubmed publisher
Saitoh N, Oritani K, Saito K, Yokota T, Ichii M, Sudo T, et al. Identification of functional domains and novel binding partners of STIM proteins. J Cell Biochem. 2011;112:147-56 pubmed publisher
Schuhmann M, Stegner D, Berna Erro A, Bittner S, Braun A, Kleinschnitz C, et al. Stromal interaction molecules 1 and 2 are key regulators of autoreactive T cell activation in murine autoimmune central nervous system inflammation. J Immunol. 2010;184:1536-42 pubmed publisher
Pani B, Ong H, Brazer S, Liu X, Rauser K, Singh B, et al. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proc Natl Acad Sci U S A. 2009;106:20087-92 pubmed publisher
Beyersdorf N, Braun A, Vögtle T, Varga Szabo D, Galdos R, Kissler S, et al. STIM1-independent T cell development and effector function in vivo. J Immunol. 2009;182:3390-7 pubmed publisher
Wu F, Wang P, Young L, Lai R, Li L. Proteome-wide identification of novel binding partners to the oncogenic fusion gene protein, NPM-ALK, using tandem affinity purification and mass spectrometry. Am J Pathol. 2009;174:361-70 pubmed publisher
Braun A, Gessner J, Varga Szabo D, Syed S, Konrad S, Stegner D, et al. STIM1 is essential for Fcgamma receptor activation and autoimmune inflammation. Blood. 2009;113:1097-104 pubmed publisher
Varga Szabo D, Braun A, Kleinschnitz C, Bender M, Pleines I, Pham M, et al. The calcium sensor STIM1 is an essential mediator of arterial thrombosis and ischemic brain infarction. J Exp Med. 2008;205:1583-91 pubmed publisher
Pani B, Ong H, Liu X, Rauser K, Ambudkar I, Singh B. Lipid rafts determine clustering of STIM1 in endoplasmic reticulum-plasma membrane junctions and regulation of store-operated Ca2+ entry (SOCE). J Biol Chem. 2008;283:17333-40 pubmed publisher
Alicia S, Angélica Z, Carlos S, Alfonso S, Vaca L. STIM1 converts TRPC1 from a receptor-operated to a store-operated channel: moving TRPC1 in and out of lipid rafts. Cell Calcium. 2008;44:479-91 pubmed publisher
Grosse J, Braun A, Varga Szabo D, Beyersdorf N, Schneider B, Zeitlmann L, et al. An EF hand mutation in Stim1 causes premature platelet activation and bleeding in mice. J Clin Invest. 2007;117:3540-50 pubmed
Prakash Y, Thompson M, Vaa B, Matabdin I, Peterson T, He T, et al. Caveolins and intracellular calcium regulation in human airway smooth muscle. Am J Physiol Lung Cell Mol Physiol. 2007;293:L1118-26 pubmed

product information

brand :

Novus

master code :

H00006786-M01

SKU :

H00006786-M01

product name :

STIM1 Antibody (5A2)

description :

The STIM1 Antibody (5A2) from Novus Biologicals is a mouse monoclonal antibody to STIM1. This antibody reacts with human, mouse, rat. The STIM1 Antibody (5A2) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA.

target :

STIM1

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

5A2

conjugate :

Unconjugated

host :

Mouse

immunogen :

SHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSEDEK
LSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDP
TVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQW
LITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGAVL
KMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVV
SIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQS
LHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQE
AQRLKELREGTENERSRQKYAEEELEQVREALRKAEKEL
ESHSSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQLL
VAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAK
QALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVA
ALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQ
SPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDR
QRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLV
EKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGS
PHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHL
AGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK
STIM1 (AAH21300, 24 a.a. ~ 685 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Mouse, Rat

specificity :

STIM1 (5A2)

gene symbol :

STIM1

catalog number base :

H00006786-M01

accessionNumbers :

AAH21300

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

GOKD11S4896E, stromal interaction molecule 1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.