SPINK1 Antibody (4D4) | Novus Biologicals H00006690-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SPINK1 Antibody (4D4)

catalog :

H00006690-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4D4

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

citations: 23

Reference
Mehner C, Miller E, Hockla A, Coban M, Weroha S, Radisky D, et al. Targeting an autocrine IL-6-SPINK1 signaling axis to suppress metastatic spread in ovarian clear cell carcinoma. Oncogene. 2020;39:6606-6618 pubmed publisher
Tiwari R, Manzar N, Bhatia V, Yadav A, Nengroo M, Datta D, et al. Androgen deprivation upregulates SPINK1 expression and potentiates cellular plasticity in prostate cancer. Nat Commun. 2020;11:384 pubmed publisher
Lu Z, Williamson S, Carskadon S, Arachchige P, Dhamdhere G, Schultz D, et al. Clonal evaluation of early onset prostate cancer by expression profiling of ERG, SPINK1, ETV1, and ETV4 on whole-mount radical prostatectomy tissue. Prostate. 2020;80:38-50 pubmed publisher
Faisal F, Kaur H, Tosoian J, Tomlins S, Schaeffer E, Lotan T. SPINK1 expression is enriched in African American prostate cancer but is not associated with altered immune infiltration or oncologic outcomes post-prostatectomy. Prostate Cancer Prostatic Dis. 2019;: pubmed publisher
Patil P, McKenney J, Reynolds J, Przybycin C, Magi Galluzzi C. Clinical significance and EZH2, ERG and SPINK1 protein expression in pure and mixed ductal adenocarcinoma of the prostate. Histol Histopathol. 2019;34:381-390 pubmed publisher
Koide H, Kimura T, Inaba H, Sato S, Iwatani K, Yorozu T, et al. Comparison of ERG and SPINK1 expression among incidental and metastatic prostate cancer in Japanese men. Prostate. 2019;79:3-8 pubmed publisher
Berglund E, Maaskola J, Schultz N, Friedrich S, Marklund M, Bergenstråhle J, et al. Spatial maps of prostate cancer transcriptomes reveal an unexplored landscape of heterogeneity. Nat Commun. 2018;9:2419 pubmed publisher
Vinceneux A, Bruyere F, Haillot O, Charles T, De La Taille A, Salomon L, et al. Ductal adenocarcinoma of the prostate: Clinical and biological profiles. Prostate. 2017;77:1242-1250 pubmed publisher
Shek F, Luo R, Lam B, Sung W, Lam T, Luk J, et al. Serine peptidase inhibitor Kazal type 1 (SPINK1) as novel downstream effector of the cadherin-17/?-catenin axis in hepatocellular carcinoma. Cell Oncol (Dordr). 2017;40:443-456 pubmed publisher
Sakata K, Araki K, Nakano H, Nishina T, Komazawa Sakon S, Murai S, et al. Novel method to rescue a lethal phenotype through integration of target gene onto the X-chromosome. Sci Rep. 2016;6:37200 pubmed publisher
Zhang J, Wang D, Hu N, Wang Q, Yu S, Wang J. The construction and proliferative effects of a lentiviral vector capable of stably overexpressing SPINK1 gene in human pancreatic cancer AsPC-1 cell line. Tumour Biol. 2016;37:5847-55 pubmed publisher
Mehner C, Oberg A, Kalli K, Nassar A, Hockla A, Pendlebury D, et al. Serine protease inhibitor Kazal type 1 (SPINK1) drives proliferation and anoikis resistance in a subset of ovarian cancers. Oncotarget. 2015;6:35737-54 pubmed publisher
Tiwari R, Pandey S, Goel S, Bhatia V, Shukla S, Jing X, et al. SPINK1 promotes colorectal cancer progression by downregulating Metallothioneins expression. Oncogenesis. 2015;4:e162 pubmed publisher
Brooks J, Wei W, Hawley S, AUMAN H, Newcomb L, Boyer H, et al. Evaluation of ERG and SPINK1 by Immunohistochemical Staining and Clinicopathological Outcomes in a Multi-Institutional Radical Prostatectomy Cohort of 1067 Patients. PLoS ONE. 2015;10:e0132343 pubmed publisher
Ateeq B, Kunju L, Carskadon S, Pandey S, Singh G, Pradeep I, et al. Molecular profiling of ETS and non-ETS aberrations in prostate cancer patients from northern India. Prostate. 2015;75:1051-62 pubmed publisher
Palanisamy N, Tsodikov A, Yan W, Suleman K, Rittmaster R, Lucia S, et al. Molecular profiling of ETS gene rearrangements in patients with prostate cancer registered in REDEEM clinical trial. Urol Oncol. 2015;33:108.e5-13 pubmed publisher
Smith S, Palanisamy N, Zuhlke K, Johnson A, Siddiqui J, Chinnaiyan A, et al. HOXB13 G84E-related familial prostate cancers: a clinical, histologic, and molecular survey. Am J Surg Pathol. 2014;38:615-26 pubmed publisher
Flavin R, Pettersson A, Hendrickson W, Fiorentino M, Finn S, Kunz L, et al. SPINK1 protein expression and prostate cancer progression. Clin Cancer Res. 2014;20:4904-11 pubmed publisher
Marshall A, Lukk M, Kutter C, Davies S, Alexander G, Odom D. Global gene expression profiling reveals SPINK1 as a potential hepatocellular carcinoma marker. PLoS ONE. 2013;8:e59459 pubmed publisher
Bhalla R, Kunju L, Tomlins S, CHRISTOPHERSON K, Cortez C, Carskadon S, et al. Novel dual-color immunohistochemical methods for detecting ERG-PTEN and ERG-SPINK1 status in prostate carcinoma. Mod Pathol. 2013;26:835-48 pubmed publisher
Rink M, Park K, Volkmer B, Xylinas E, Hansen J, Cha E, et al. Loss of SPINK1 expression is associated with unfavorable outcomes in urothelial carcinoma of the bladder after radical cystectomy. Urol Oncol. 2013;31:1716-24 pubmed publisher
Han B, Mehra R, Suleman K, Tomlins S, Wang L, Singhal N, et al. Characterization of ETS gene aberrations in select histologic variants of prostate carcinoma. Mod Pathol. 2009;22:1176-85 pubmed publisher
Tomlins S, Rhodes D, Yu J, Varambally S, Mehra R, Perner S, et al. The role of SPINK1 in ETS rearrangement-negative prostate cancers. Cancer Cell. 2008;13:519-28 pubmed publisher

product information

brand :

Novus

master code :

H00006690-M01

SKU :

H00006690-M01

product name :

SPINK1 Antibody (4D4)

description :

The SPINK1 Antibody (4D4) from Novus Biologicals is a mouse monoclonal antibody to SPINK1. This antibody reacts with human, mouse. The SPINK1 Antibody (4D4) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Sandwich ELISA.

target :

SPINK1

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4D4

conjugate :

Unconjugated

host :

Mouse

immunogen :

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCF
ENRKRQTSILIQKSGPC
SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Mouse

specificity :

SPINK1 - serine protease inhibitor, Kazal type 1

gene symbol :

SPINK1

catalog number base :

H00006690-M01

accessionNumbers :

AAH25790

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

pancreatic secretory trypsin inhibitor, PCTTSpink3, PSTISerine protease inhibitor Kazal-type 1, serine peptidase inhibitor, Kazal type 1, serine protease inhibitor, Kazal type 1, TATITumor-associated trypsin inhibitor

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.