SOX9 Antibody (3C10) | Novus Biologicals H00006662-M02 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SOX9 Antibody (3C10)

catalog :

H00006662-M02

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3C10

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

citations: 8

Reference
Janssen J, Batschkus S, Schimmel S, Bode C, Schminke B, Miosge N. The Influence of TGF-β3, EGF, and BGN on SOX9 and RUNX2 Expression in Human Chondrogenic Progenitor Cells. J Histochem Cytochem. 2019;67:117-127 pubmed publisher
Yang Z, Zhang C, Qi W, Cui Y, Xuan Y. GLI1 promotes cancer stemness through intracellular signaling pathway PI3K/Akt/NFκB in colorectal adenocarcinoma. Exp Cell Res. 2018;373:145-154 pubmed publisher
Jurczyk A, Nowosielska A, Przewozniak N, Aryee K, Diiorio P, Blodgett D, et al. Beyond the brain: disrupted in schizophrenia 1 regulates pancreatic Î²-cell function via glycogen synthase kinase-3Î². FASEB J. 2016;30:983-93 pubmed publisher
Burdelski C, Bujupi E, Tsourlakis M, Hube Magg C, Kluth M, Melling N, et al. Loss of SOX9 Expression Is Associated with PSA Recurrence in ERG-Positive and PTEN Deleted Prostate Cancers. PLoS ONE. 2015;10:e0128525 pubmed publisher
Loebel C, Czekanska E, Bruderer M, Salzmann G, Alini M, Stoddart M. In vitro osteogenic potential of human mesenchymal stem cells is predicted by Runx2/Sox9 ratio. Tissue Eng Part A. 2015;21:115-23 pubmed publisher
Yun J, Kim Y, Choe J, Min H, Lee K, Jung Y, et al. Expression of cancer stem cell markers is more frequent in anaplastic thyroid carcinoma compared to papillary thyroid carcinoma and is related to adverse clinical outcome. J Clin Pathol. 2014;67:125-33 pubmed publisher
Hagel C, Treszl A, Fehlert J, Harder J, von Haxthausen F, Kern M, et al. Supra- and infratentorial pediatric ependymomas differ significantly in NeuN, p75 and GFAP expression. J Neurooncol. 2013;112:191-7 pubmed publisher
Hodgin J, Borczuk A, Nasr S, Markowitz G, Nair V, Martini S, et al. A molecular profile of focal segmental glomerulosclerosis from formalin-fixed, paraffin-embedded tissue. Am J Pathol. 2010;177:1674-86 pubmed publisher

product information

brand :

Novus

master code :

H00006662-M02

SKU :

H00006662-M02

product name :

SOX9 Antibody (3C10)

description :

The SOX9 Antibody (3C10) from Novus Biologicals is a mouse monoclonal antibody to SOX9. This antibody reacts with human. The SOX9 Antibody (3C10) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, In-situ Hybridization, Sandwich ELISA.

target :

SOX9

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3C10

conjugate :

Unconjugated

host :

Mouse

immunogen :

EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRS
QYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMY
TPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human

specificity :

SOX9 (3C10)

gene symbol :

SOX9

catalog number base :

H00006662-M02

accessionNumbers :

NP_000337

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, In-situ Hybridization, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

campomelic dysplasia, autosomal sex-reversal, CMD 1, CMD1, CMPD1, SRA1SRY (sex-determining region Y)-box 9 protein, SRY (sex determining region Y)-box 9, SRY-related HMG-box, gene 9, transcription factor SOX-9

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.