S100A4 Antibody (1F12-1G7) | Novus Biologicals H00006275-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

S100A4 Antibody (1F12-1G7)

catalog :

H00006275-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1F12-1G7

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry

citations: 15

Reference
Kan C, Ding N, Yang J, Tan Z, McGuire T, Lu H, et al. BMP-dependent, injury-induced stem cell niche as a mechanism of heterotopic ossification. Stem Cell Res Ther. 2019;10:14 pubmed publisher
Liu T, Ma W, Xu H, Huang M, Zhang D, He Z, et al. PDGF-mediated mesenchymal transformation renders endothelial resistance to anti-VEGF treatment in glioblastoma. Nat Commun. 2018;9:3439 pubmed publisher
Kan C, Chen L, Hu Y, Ding N, Li Y, McGuire T, et al. Gli1-labeled adult mesenchymal stem/progenitor cells and hedgehog signaling contribute to endochondral heterotopic ossification. Bone. 2018;109:71-79 pubmed publisher
Cosme J, Guo H, Hadipour Lakmehsari S, Emili A, Gramolini A. Hypoxia-Induced Changes in the Fibroblast Secretome, Exosome, and Whole-Cell Proteome Using Cultured, Cardiac-Derived Cells Isolated from Neonatal Mice. J Proteome Res. 2017;16:2836-2847 pubmed publisher
Lin S, Lee Y, Yu G, Cheng C, Zhou X, Chu K, et al. Endothelial-to-Osteoblast Conversion Generates Osteoblastic Metastasis of Prostate Cancer. Dev Cell. 2017;41:467-480.e3 pubmed publisher
Singh K, Lovren F, Pan Y, Quan A, Ramadan A, Matkar P, et al. The essential autophagy gene ATG7 modulates organ fibrosis via regulation of endothelial-to-mesenchymal transition. J Biol Chem. 2015;290:2547-59 pubmed publisher
Volonté A, Di Tomaso T, Spinelli M, Todaro M, Sanvito F, Albarello L, et al. Cancer-initiating cells from colorectal cancer patients escape from T cell-mediated immunosurveillance in vitro through membrane-bound IL-4. J Immunol. 2014;192:523-32 pubmed publisher
Birbrair A, Zhang T, Wang Z, Messi M, Mintz A, Delbono O. Type-1 pericytes participate in fibrous tissue deposition in aged skeletal muscle. Am J Physiol Cell Physiol. 2013;305:C1098-113 pubmed publisher
Li Q, Zhang D, WANG Y, Sun P, Hou X, Larner J, et al. MiR-21/Smad 7 signaling determines TGF-?1-induced CAF formation. Sci Rep. 2013;3:2038 pubmed publisher
Kan L, Peng C, McGuire T, Kessler J. Glast-expressing progenitor cells contribute to heterotopic ossification. Bone. 2013;53:194-203 pubmed publisher
Chen Y, Huang K, Nakatsu M, Xue Z, Deng S, Fan G. Identification of novel molecular markers through transcriptomic analysis in human fetal and adult corneal endothelial cells. Hum Mol Genet. 2013;22:1271-9 pubmed publisher
Swift Gallant A, Monks D. Androgen receptor expression in satellite cells of the neonatal levator ani of the rat. Dev Neurobiol. 2013;73:448-54 pubmed publisher
Nishioku T, Furusho K, Tomita A, Ohishi H, Dohgu S, Shuto H, et al. Potential role for S100A4 in the disruption of the blood-brain barrier in collagen-induced arthritic mice, an animal model of rheumatoid arthritis. Neuroscience. 2011;189:286-92 pubmed publisher
Zeisberg E, Potenta S, Xie L, Zeisberg M, Kalluri R. Discovery of endothelial to mesenchymal transition as a source for carcinoma-associated fibroblasts. Cancer Res. 2007;67:10123-8 pubmed
Chen P, Wang M, Wu S, Su J, Hong C, Chuang S, et al. CTGF enhances the motility of breast cancer cells via an integrin-alphavbeta3-ERK1/2-dependent S100A4-upregulated pathway. J Cell Sci. 2007;120:2053-65 pubmed

product information

brand :

Novus

master code :

H00006275-M01

SKU :

H00006275-M01

product name :

S100A4 Antibody (1F12-1G7)

description :

The S100A4 Antibody (1F12-1G7) from Novus Biologicals is a mouse monoclonal antibody to S100A4. This antibody reacts with human, mouse, rat. The S100A4 Antibody (1F12-1G7) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Sandwich ELISA.

target :

S100A4

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1F12-1G7

conjugate :

Unconjugated

host :

Mouse

immunogen :

MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLT
RELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVF
LSCIAMMCDEFFEGFPDKQPRKK
S100A4 (AAH16300, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human, Mouse, Rat

specificity :

S100A4 - S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)

gene symbol :

S100A4

catalog number base :

H00006275-M01

accessionNumbers :

AAH16300

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

18A2, Calvasculin, CAPLS100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, fibroblast-specific protein-1,42A, FSP1, leukemia multidrug resistance associated protein, malignant transformation suppression 1, Metastasin, MTS1, murine placental homolog), P9KA, PEL98, Placental calcium-binding protein, Protein Mts1, protein S100-A4, S100 calcium binding protein A4, S100 calcium-binding protein A4, S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.