Rab27a Antibody (1G7) | Novus Biologicals H00005873-M02 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Rab27a Antibody (1G7)

catalog :

H00005873-M02

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1G7

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, flow cytometry, immunohistochemistry - paraffin section

citations: 12

Reference
Felicetti F, De Feo A, Coscia C, Puglisi R, Pedini F, Pasquini L, et al. Exosome-mediated transfer of miR-222 is sufficient to increase tumor malignancy in melanoma. J Transl Med. 2016;14:56 pubmed publisher
Fang Y, Garnier D, Lee T, D Asti E, Montermini L, Meehan B, et al. PML-RARa modulates the vascular signature of extracellular vesicles released by acute promyelocytic leukemia cells. Angiogenesis. 2016;19:25-38 pubmed publisher
Chen T, Hsieh C, Sarnow P. Supporting Role for GTPase Rab27a in Hepatitis C Virus RNA Replication through a Novel miR-122-Mediated Effect. PLoS Pathog. 2015;11:e1005116 pubmed publisher
Hannafon B, Carpenter K, Berry W, Janknecht R, Dooley W, Ding W. Exosome-mediated microRNA signaling from breast cancer cells is altered by the anti-angiogenesis agent docosahexaenoic acid (DHA). Mol Cancer. 2015;14:133 pubmed publisher
Cetica V, Hackmann Y, Grieve S, Sieni E, Ciambotti B, Coniglio M, et al. Patients with Griscelli syndrome and normal pigmentation identify RAB27A mutations that selectively disrupt MUNC13-4 binding. J Allergy Clin Immunol. 2015;135:1310-8.e1 pubmed publisher
Kimura T, Yamaoka M, Taniguchi S, Okamoto M, Takei M, Ando T, et al. Activated Cdc42-bound IQGAP1 determines the cellular endocytic site. Mol Cell Biol. 2013;33:4834-43 pubmed publisher
Peinado H, AleÄkoviÄ‡ M, Lavotshkin S, Matei I, Costa Silva B, Moreno Bueno G, et al. Melanoma exosomes educate bone marrow progenitor cells toward a pro-metastatic phenotype through MET. Nat Med. 2012;18:883-91 pubmed publisher
Sanchez Ruiz Y, Valitutti S, Dupré L. Stepwise maturation of lytic granules during differentiation and activation of human CD8+ T lymphocytes. PLoS ONE. 2011;6:e27057 pubmed publisher
Chiang L, Ngo J, Schechter J, Karvar S, Tolmachova T, Seabra M, et al. Rab27b regulates exocytosis of secretory vesicles in acinar epithelial cells from the lacrimal gland. Am J Physiol Cell Physiol. 2011;301:C507-21 pubmed publisher
Neumüller O, Hoffmeister M, Babica J, Prelle C, Gegenbauer K, Smolenski A. Synaptotagmin-like protein 1 interacts with the GTPase-activating protein Rap1GAP2 and regulates dense granule secretion in platelets. Blood. 2009;114:1396-404 pubmed publisher
Shanmugam C, Katkoori V, Jhala N, Grizzle W, Manne U. Immunohistochemical expression of rabphilin-3A-like (Noc2) in normal and tumor tissues of human endocrine pancreas. Biotech Histochem. 2009;84:39-45 pubmed publisher
Kimura T, Kaneko Y, Yamada S, Ishihara H, Senda T, Iwamatsu A, et al. The GDP-dependent Rab27a effector coronin 3 controls endocytosis of secretory membrane in insulin-secreting cell lines. J Cell Sci. 2008;121:3092-8 pubmed publisher

product information

brand :

Novus

master code :

H00005873-M02

SKU :

H00005873-M02

product name :

Rab27a Antibody (1G7)

description :

The Rab27a Antibody (1G7) from Novus Biologicals is a mouse monoclonal antibody to Rab27a. This antibody reacts with human, mouse, rabbit. The Rab27a Antibody (1G7) has been validated for the following applications: Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition, Sandwich ELISA.

target :

Rab27a

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1G7

conjugate :

Unconjugated

host :

Mouse

immunogen :

YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYF
ETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVV
RSNGHASTDQLSEEKEKGACGC
RAB27A (NP_004571, 122 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human, Mouse, Rabbit

specificity :

RAB27A - RAB27A, member RAS oncogene family

gene symbol :

RAB27A

catalog number base :

H00005873-M02

accessionNumbers :

NP_004571

applications :

Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

GS2rab-27, GTP-binding protein Ram, HsT18676, Rab-27, RAB27A, member RAS oncogene family, RAB27MGC117246, RAMras-related protein Rab-27A

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.