Pleiotrophin/PTN Antibody (5C3) | Novus Biologicals H00005764-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Pleiotrophin/PTN Antibody (5C3)

catalog :

H00005764-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

5C3

reactivity :

human, rat, chicken

application :

western blot, ELISA, immunohistochemistry, immunoprecipitation, immunohistochemistry - paraffin section, proximity ligation assay

citations: 7

Reference
Kaspiris A, Mikelis C, Heroult M, Khaldi L, Grivas T, Kouvaras I, et al. Expression of the growth factor pleiotrophin and its receptor protein tyrosine phosphatase beta/zeta in the serum, cartilage and subchondral bone of patients with osteoarthritis. Joint Bone Spine. 2013;80:407-13 pubmed publisher
Koutsioumpa M, Polytarchou C, Courty J, Zhang Y, Kieffer N, Mikelis C, et al. Interplay between ?v?3 integrin and nucleolin regulates human endothelial and glioma cell migration. J Biol Chem. 2013;288:343-54 pubmed publisher
Miao J, Ding M, Zhang A, Xiao Z, Qi W, Luo N, et al. Pleiotrophin promotes microglia proliferation and secretion of neurotrophic factors by activating extracellular signal-regulated kinase 1/2 pathway. Neurosci Res. 2012;74:269-76 pubmed publisher
Tsirmoula S, Dimas K, Hatziapostolou M, Lamprou M, Ravazoula P, Papadimitriou E. Implications of pleiotrophin in human PC3 prostate cancer cell growth in vivo. Cancer Sci. 2012;103:1826-32 pubmed publisher
Mikelis C, Lamprou M, Koutsioumpa M, Koutsioubas A, Spyranti Z, Zompra A, et al. A peptide corresponding to the C-terminal region of pleiotrophin inhibits angiogenesis in vivo and in vitro. J Cell Biochem. 2011;112:1532-43 pubmed publisher
Mikelis C, Sfaelou E, Koutsioumpa M, Kieffer N, Papadimitriou E. Integrin alpha(v)beta(3) is a pleiotrophin receptor required for pleiotrophin-induced endothelial cell migration through receptor protein tyrosine phosphatase beta/zeta. FASEB J. 2009;23:1459-69 pubmed publisher
Koutsioumpa M, Hatziapostolou M, Mikelis C, Koolwijk P, Papadimitriou E. Aprotinin stimulates angiogenesis and human endothelial cell migration through the growth factor pleiotrophin and its receptor protein tyrosine phosphatase beta/zeta. Eur J Pharmacol. 2009;602:245-9 pubmed publisher

product information

brand :

Novus

master code :

H00005764-M01

SKU :

H00005764-M01

product name :

Pleiotrophin/PTN Antibody (5C3)

description :

The Pleiotrophin/PTN Antibody (5C3) from Novus Biologicals is a mouse monoclonal antibody to Pleiotrophin/PTN. This antibody reacts with human, rat, chicken. The Pleiotrophin/PTN Antibody (5C3) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin, Proximity Ligation Assay.

target :

Pleiotrophin/PTN

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

5C3

conjugate :

Unconjugated

host :

Mouse

immunogen :

SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQ
RCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSL
KRALHNAECQKTVTISKPCGKLTKPKPQAESK
PTN (NP_002816, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human, Rat, Chicken

specificity :

PTN - pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1)

gene symbol :

PTN

catalog number base :

H00005764-M01

accessionNumbers :

NP_002816

applications :

Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin, Proximity Ligation Assay

2020 USD :

399

2021 USD :

399 USD

alt names :

HARP, HBBM, HB-GAM, HBGF8, HBNF, HBNF1, HBNF-1, Heparin-binding brain mitogen, NEGF1HBGF-8, neurite growth-promoting factor 1, neurite growth-promoting factor1), OSF-1, Osteoblast-specific factor 1, pleiotrophin

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.