This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Lysosomal Pro-X Carboxypeptidase/PRCP Antibody
catalog :
H00005547-B01P
quantity :
0.05 mg
price :
499 USD
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot
product information
brand :
Novus
master code :
H00005547-B01P
SKU :
H00005547-B01P
product name :
Lysosomal Pro-X Carboxypeptidase/PRCP Antibody
unit size :
0.05 mg
seo description :
The Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - Azide and BSA Free from Novus is a mouse polyclonal antibody to Lysosomal Pro-X Carboxypeptidase/PRCP. This antibody reacts with human,rat. The Lysosomal Pro-X Carboxypeptidase/PRCP Antibody - Azide and BSA Free has been validated for the following applications: Western Blot.
target :
Lysosomal Pro-X Carboxypeptidase/PRCP
category :
Primary Antibodies
buffer :
PBS (pH 7.4)
clonality :
Polyclonal
conjugate :
Unconjugated
dilution :
Western Blot
host :
Mouse
immunogen :
MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPT
SLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKY
WKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAML
VFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAE
LIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHM
VVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCS
ESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQ
HLKDWISETWVNLAMVDYPYASNFLQPLPAWPIKVVCQY
LKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETAT
SSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKEL
SDDCFQQWGVRPRPSWITTMYGGKNISSHTNIVFSNGEL
DPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPM
SVLLARSLEVRHMKNWIRDFYDSAGKQH
PRCP (NP_005031.1, 1 a.a. - 496 a.a.) full-length human protein.
SLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKY
WKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAML
VFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAE
LIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHM
VVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCS
ESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQ
HLKDWISETWVNLAMVDYPYASNFLQPLPAWPIKVVCQY
LKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETAT
SSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKEL
SDDCFQQWGVRPRPSWITTMYGGKNISSHTNIVFSNGEL
DPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPM
SVLLARSLEVRHMKNWIRDFYDSAGKQH
PRCP (NP_005031.1, 1 a.a. - 496 a.a.) full-length human protein.
isotype :
IgG
purity :
Protein A purified
species :
Human,Rat
specificity :
PRCP - prolylcarboxypeptidase (angiotensinase C),
gene symbol :
PRCP
accessionNumbers :
NP_005031.1
applications :
Western Blot
USD :
499 USD
alt names :
Angiotensinase C, EC 3.4.16.2, HUMPCP, Lysosomal carboxypeptidase C, lysosomal Pro-X carboxypeptidase, PCPMGC2202, Proline carboxypeptidase, Prolylcarboxypeptidase, prolylcarboxypeptidase (angiotensinase C), prolylcarboxypeptidase isoform 1 preproprotein
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
