This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Cyclophilin A Antibody (1F4-1B5)
catalog :
H00005478-M01
quantity :
0.1 mg
price :
399 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1F4-1B5
reactivity :
human
application :
western blot, ELISA
product information
SKU :
H00005478-M01
Product Name :
Cyclophilin A Antibody (1F4-1B5)
Size :
0.1 mg
Description :
The Cyclophilin A Antibody (1F4-1B5) from Novus Biologicals is a mouse monoclonal antibody to Cyclophilin A. This antibody reacts with human. The Cyclophilin A Antibody (1F4-1B5) has been validated for the following applications: Western Blot, ELISA.
Target :
Cyclophilin A
Category :
Primary Antibodies
Buffer :
PBS (pH 7.4)
Clonality :
Monoclonal
Clone :
1F4-1B5
Conjugate :
Unconjugated
Host :
Mouse
Immunogen :
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRAL
STGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSI
YGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTA
KTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKI
TIADCGQLE
PPIA (AAH00689.1, 1 a.a. - 165 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
STGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSI
YGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTA
KTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKI
TIADCGQLE
PPIA (AAH00689.1, 1 a.a. - 165 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype :
IgG2a Kappa
Purity :
IgG purified
Species Reactivity :
Human
Gene Symbol :
PPIA
AccessionNumbers :
AAH00689
Applications :
Western Blot, ELISA
Price :
399 USD
Alternate Names :
Cyclophilin A, Cyclosporin A-binding protein, CYPAMGC12404, CYPH, EC 5.2.1.8, MGC117158, MGC23397, peptidyl-prolyl cis-trans isomerase A, peptidylprolyl isomerase A (cyclophilin A), PPIase A, Rotamase A, T cell cyclophilin
Storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
