6 Phosphofructo 2 Kinase Antibody (3F3) | Novus Biologicals H00005209-M08 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

6 Phosphofructo 2 Kinase Antibody (3F3)

catalog :

H00005209-M08

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3F3

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunoprecipitation

citations: 12

Reference
Burmistrova O, Olias Arjona A, Lapresa R, Jimenez Blasco D, Eremeeva T, Shishov D, et al. Targeting PFKFB3 alleviates cerebral ischemia-reperfusion injury in mice. Sci Rep. 2019;9:11670 pubmed publisher
Rodriguez C, Sánchez Morán I, Alvarez S, Tirado P, Fernández Mayoralas D, Calleja Pérez B, et al. A novel human Cdh1 mutation impairs anaphase promoting complex/cyclosome activity resulting in microcephaly, psychomotor retardation, and epilepsy. J Neurochem. 2019;151:103-115 pubmed publisher
Ohmura M, Hishiki T, Yamamoto T, Nakanishi T, Kubo A, Tsuchihashi K, et al. Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry. Nitric Oxide. 2015;46:102-13 pubmed publisher
Desideri E, Vegliante R, Cardaci S, Nepravishta R, Paci M, Ciriolo M. MAPK14/p38?-dependent modulation of glucose metabolism affects ROS levels and autophagy during starvation. Autophagy. 2014;10:1652-65 pubmed publisher
Yamamoto T, Takano N, Ishiwata K, Ohmura M, Nagahata Y, Matsuura T, et al. Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway. Nat Commun. 2014;5:3480 pubmed publisher
Cordero Espinoza L, Hagen T. Increased concentrations of fructose 2,6-bisphosphate contribute to the Warburg effect in phosphatase and tensin homolog (PTEN)-deficient cells. J Biol Chem. 2013;288:36020-8 pubmed publisher
Bao Y, Mukai K, Hishiki T, Kubo A, Ohmura M, Sugiura Y, et al. Energy management by enhanced glycolysis in G1-phase in human colon cancer cells in vitro and in vivo. Mol Cancer Res. 2013;11:973-85 pubmed publisher
Huang Y, Bell L, Okamura J, Kim M, Mohney R, Guerrero Preston R, et al. Phospho-?Np63?/SREBF1 protein interactions: bridging cell metabolism and cisplatin chemoresistance. Cell Cycle. 2012;11:3810-27 pubmed publisher
Rodríguez Rodríguez P, Fernandez E, Almeida A, Bolanos J. Excitotoxic stimulus stabilizes PFKFB3 causing pentose-phosphate pathway to glycolysis switch and neurodegeneration. Cell Death Differ. 2012;19:1582-9 pubmed publisher
Almeida A, Bolanos J, Moncada S. E3 ubiquitin ligase APC/C-Cdh1 accounts for the Warburg effect by linking glycolysis to cell proliferation. Proc Natl Acad Sci U S A. 2010;107:738-41 pubmed publisher
Amako Y, Sarkeshik A, Hotta H, Yates J, Siddiqui A. Role of oxysterol binding protein in hepatitis C virus infection. J Virol. 2009;83:9237-46 pubmed publisher
Yalcin A, Clem B, Simmons A, Lane A, Nelson K, Clem A, et al. Nuclear targeting of 6-phosphofructo-2-kinase (PFKFB3) increases proliferation via cyclin-dependent kinases. J Biol Chem. 2009;284:24223-32 pubmed publisher

product information

brand :

Novus

master code :

H00005209-M08

SKU :

H00005209-M08

product name :

6 Phosphofructo 2 Kinase Antibody (3F3)

description :

The 6 Phosphofructo 2 Kinase Antibody (3F3) from Novus Biologicals is a mouse monoclonal antibody to 6 Phosphofructo 2 Kinase. This antibody reacts with human, mouse, rat. The 6 Phosphofructo 2 Kinase Antibody (3F3) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation, Sandwich ELISA.

target :

6-phosphofructo-2-kinase

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3F3

conjugate :

Unconjugated

host :

Mouse

immunogen :

CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAK
KGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAA
LPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
PFKFB3 (NP_004557, 412 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Mouse, Rat

specificity :

PFKFB3 - 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (3F3)

gene symbol :

PFKFB3

catalog number base :

H00005209-M08

accessionNumbers :

NP_004557

applications :

Western Blot, ELISA, Immunoprecipitation, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

6PF-2-K/Fru-2,6-P2ase 3,6-bisphosphatase, 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3,6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, FLJ37326, inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, IPFK2, Renal carcinoma antigen NY-REN-56

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.