PCBP2 Antibody (5F12) | Novus Biologicals H00005094-M07 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

PCBP2 Antibody (5F12)

catalog :

H00005094-M07

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

5F12

reactivity :

human, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

citations: 13

Reference
Roth H, Magg V, Uch F, Mutz P, Klein P, Haneke K, et al. Flavivirus Infection Uncouples Translation Suppression from Cellular Stress Responses. MBio. 2017;8: pubmed publisher
Yanatori I, Richardson D, Imada K, Kishi F. Iron Export through the Transporter Ferroportin 1 Is Modulated by the Iron Chaperone PCBP2. J Biol Chem. 2016;291:17303-18 pubmed publisher
Li F, Bullough K, Vashisht A, Wohlschlegel J, Philpott C. Poly(rC)-Binding Protein 2 Regulates Hippo Signaling To Control Growth in Breast Epithelial Cells. Mol Cell Biol. 2016;36:2121-31 pubmed publisher
Li Y, Masaki T, Shimakami T, Lemon S. hnRNP L and NF90 interact with hepatitis C virus 5'-terminal untranslated RNA and promote efficient replication. J Virol. 2014;88:7199-209 pubmed publisher
Ho J, Robb G, Tai S, Turgeon P, Mawji I, Man H, et al. Active stabilization of human endothelial nitric oxide synthase mRNA by hnRNP E1 protects against antisense RNA and microRNAs. Mol Cell Biol. 2013;33:2029-46 pubmed publisher
Fujimura K, Sasaki A, Anderson P. Selenite targets eIF4E-binding protein-1 to inhibit translation initiation and induce the assembly of non-canonical stress granules. Nucleic Acids Res. 2012;40:8099-110 pubmed publisher
Nandal A, Ruiz J, Subramanian P, Ghimire Rijal S, Sinnamon R, Stemmler T, et al. Activation of the HIF prolyl hydroxylase by the iron chaperones PCBP1 and PCBP2. Cell Metab. 2011;14:647-57 pubmed publisher
Wang L, Jeng K, Lai M. Poly(C)-binding protein 2 interacts with sequences required for viral replication in the hepatitis C virus (HCV) 5' untranslated region and directs HCV RNA replication through circularizing the viral genome. J Virol. 2011;85:7954-64 pubmed publisher
Lawrence P, Rieder E. Identification of RNA helicase A as a new host factor in the replication cycle of foot-and-mouth disease virus. J Virol. 2009;83:11356-66 pubmed publisher
Fujimura K, Katahira J, Kano F, Yoneda Y, Murata M. Selective localization of PCBP2 to cytoplasmic processing bodies. Biochim Biophys Acta. 2009;1793:878-87 pubmed publisher
Süss C, Czupalla C, Winter C, Pursche T, Knoch K, Schroeder M, et al. Rapid changes of mRNA-binding protein levels following glucose and 3-isobutyl-1-methylxanthine stimulation of insulinoma INS-1 cells. Mol Cell Proteomics. 2009;8:393-408 pubmed publisher
Ghosh D, Srivastava G, Xu D, Schulz L, Roberts R. A link between SIN1 (MAPKAP1) and poly(rC) binding protein 2 (PCBP2) in counteracting environmental stress. Proc Natl Acad Sci U S A. 2008;105:11673-8 pubmed publisher
Fujimura K, Kano F, Murata M. Identification of PCBP2, a facilitator of IRES-mediated translation, as a novel constituent of stress granules and processing bodies. RNA. 2008;14:425-31 pubmed publisher

product information

brand :

Novus

master code :

H00005094-M07

SKU :

H00005094-M07

product name :

PCBP2 Antibody (5F12)

description :

The PCBP2 Antibody (5F12) from Novus Biologicals is a mouse monoclonal antibody to PCBP2. This antibody reacts with human, rat. The PCBP2 Antibody (5F12) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition, Sandwich ELISA.

target :

PCBP2

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

5F12

conjugate :

Unconjugated

host :

Mouse

immunogen :

MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKM
REESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDK
LEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGG
CKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSII
ECVKQICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQDR
YSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAI
PQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKG
YWAGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQ
MSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVR
LSSETGGMGSS
PCBP2 (AAH01155, 1 a.a. ~ 362 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Rat

specificity :

PCBP2 - poly(rC) binding protein 2

gene symbol :

PCBP2

catalog number base :

H00005094-M07

accessionNumbers :

AAH01155

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

alpha-CP2, Heterogeneous nuclear ribonucleoprotein E2, heterogenous nuclear ribonucleoprotein E2, hnRNP E2, hnRNP-E2, HNRPE2, MGC110998, poly(rC) binding protein 2, poly(rC)-binding protein 2

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.