PBX1 Antibody (4A2) | Novus Biologicals H00005087-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

PBX1 Antibody (4A2)

catalog :

H00005087-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4A2

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, chromatin immunoprecipitation, immunohistochemistry - paraffin section

citations: 9

Reference
Toska E, Castel P, Chhangawala S, Arruabarrena Aristorena A, Chan C, Hristidis V, et al. PI3K Inhibition Activates SGK1 via a Feedback Loop to Promote Chromatin-Based Regulation of ER-Dependent Gene Expression. Cell Rep. 2019;27:294-306.e5 pubmed publisher
Wang J, Shidfar A, Ivancic D, Ranjan M, Liu L, Choi M, et al. Overexpression of lipid metabolism genes and PBX1 in the contralateral breasts of women with estrogen receptor-negative breast cancer. Int J Cancer. 2017;140:2484-2497 pubmed publisher
Ramberg H, Grytli H, Nygard S, Wang W, Ogren O, Zhao S, et al. PBX3 is a putative biomarker of aggressive prostate cancer. Int J Cancer. 2016;139:1810-20 pubmed publisher
Dell Orso S, Wang A, Shih H, Saso K, Berghella L, Gutierrez Cruz G, et al. The Histone Variant MacroH2A1.2 Is Necessary for the Activation of Muscle Enhancers and Recruitment of the Transcription Factor Pbx1. Cell Rep. 2016;14:1156-1168 pubmed publisher
Nguyen V, Barozzi I, Faronato M, Lombardo Y, Steel J, Patel N, et al. Differential epigenetic reprogramming in response to specific endocrine therapies promotes cholesterol biosynthesis and cellular invasion. Nat Commun. 2015;6:10044 pubmed publisher
Magnani L, Ballantyne E, Zhang X, Lupien M. PBX1 genomic pioneer function drives ER? signaling underlying progression in breast cancer. PLoS Genet. 2011;7:e1002368 pubmed publisher
Bjerke G, Hyman Walsh C, Wotton D. Cooperative transcriptional activation by Klf4, Meis2, and Pbx1. Mol Cell Biol. 2011;31:3723-33 pubmed publisher
Horman S, Velu C, Chaubey A, Bourdeau T, Zhu J, Paul W, et al. Gfi1 integrates progenitor versus granulocytic transcriptional programming. Blood. 2009;113:5466-75 pubmed publisher
Cheung C, Chan B, Chan V, Ikegawa S, Kou I, Ngai H, et al. Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation. Hum Mol Genet. 2009;18:679-87 pubmed publisher

product information

brand :

Novus

master code :

H00005087-M01

SKU :

H00005087-M01

product name :

PBX1 Antibody (4A2)

description :

The PBX1 Antibody (4A2) from Novus Biologicals is a mouse monoclonal antibody to PBX1. This antibody reacts with human, mouse, monkey. The PBX1 Antibody (4A2) has been validated for the following applications: Western Blot, Chromatin Immunoprecipitation, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA.

target :

PBX1

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4A2

conjugate :

Unconjugated

host :

Mouse

immunogen :

MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEY
FYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR
YKKNIGKFQEEANIYAAKTAVTATNVSAHGS
PBX1 (NP_002576, 213 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Mouse, Monkey

specificity :

PBX1 - pre-B-cell leukemia transcription factor 1

gene symbol :

PBX1

catalog number base :

H00005087-M01

accessionNumbers :

NP_002576

applications :

Western Blot, Chromatin Immunoprecipitation, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

DKFZp686B09108, Homeobox protein PBX1, Homeobox protein PRL, MGC126627, Pre-B cell leukemia transcription factor-1, pre-B-cell leukemia homeobox 1, pre-B-cell leukemia transcription factor 1, PRL

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.