Pax2 Antibody (3C7) | Novus Biologicals H00005076-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Pax2 Antibody (3C7)

catalog :

H00005076-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3C7

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

citations: 9

Reference
Wang Y, Wang L, Zhu Y, Qin J. Human brain organoid-on-a-chip to model prenatal nicotine exposure. Lab Chip. 2018;18:851-860 pubmed publisher
Patel D, Shimomura A, Majumdar S, Holley M, Hashino E. The histone demethylase LSD1 regulates inner ear progenitor differentiation through interactions with Pax2 and the NuRD repressor complex. PLoS ONE. 2018;13:e0191689 pubmed publisher
Zhu Y, Wang L, Yin F, Yu Y, Wang Y, Shepard M, et al. Probing impaired neurogenesis in human brain organoids exposed to alcohol. Integr Biol (Camb). 2017;9:968-978 pubmed publisher
Zhu Y, Wang L, Yu H, Yin F, Wang Y, Liu H, et al. In situ generation of human brain organoids on a micropillar array. Lab Chip. 2017;17:2941-2950 pubmed publisher
Vinci L, Ravarino A, Fanos V, Naccarato A, Senes G, Gerosa C, et al. Immunohistochemical markers of neural progenitor cells in the early embryonic human cerebral cortex. Eur J Histochem. 2016;60:2563 pubmed publisher
Lancaster M, Renner M, Martin C, Wenzel D, Bicknell L, Hurles M, et al. Cerebral organoids model human brain development and microcephaly. Nature. 2013;501:373-9 pubmed publisher
Koehler K, Mikosz A, Molosh A, Patel D, Hashino E. Generation of inner ear sensory epithelia from pluripotent stem cells in 3D culture. Nature. 2013;500:217-21 pubmed publisher
Bains O, Grigliatti T, Reid R, Riggs K. Naturally occurring variants of human aldo-keto reductases with reduced in vitro metabolism of daunorubicin and doxorubicin. J Pharmacol Exp Ther. 2010;335:533-45 pubmed publisher
Muguruma K, Nishiyama A, Ono Y, Miyawaki H, Mizuhara E, Hori S, et al. Ontogeny-recapitulating generation and tissue integration of ES cell-derived Purkinje cells. Nat Neurosci. 2010;13:1171-80 pubmed publisher

product information

brand :

Novus

master code :

H00005076-M01

SKU :

H00005076-M01

product name :

Pax2 Antibody (3C7)

description :

The Pax2 Antibody (3C7) from Novus Biologicals is a mouse monoclonal antibody to Pax2. This antibody reacts with human, mouse. The Pax2 Antibody (3C7) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Sandwich ELISA.

target :

Pax2

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3C7

conjugate :

Unconjugated

host :

Mouse

immunogen :

PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADT
FTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLP
ALTPGLDEVKSSLSASTNPELGSNVSGTQTYP
PAX2 (NP_000269, 194 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Mouse

specificity :

PAX2 - paired box gene 2

gene symbol :

PAX2

catalog number base :

H00005076-M01

accessionNumbers :

NP_000269

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

paired box 2, paired box gene 2, paired box homeotic gene 2, paired box protein Pax-2

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.