NRAMP2/SLC11A2/DMT1 Antibody (4C6) | Novus Biologicals H00004891-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

NRAMP2/SLC11A2/DMT1 Antibody (4C6)

catalog :

H00004891-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4C6

reactivity :

human, mouse, bovine

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

citations: 9

Reference
Zhao L, BARTNIKAS T, Chu X, Klein J, Yun C, Srinivasan S, et al. Hyperglycemia promotes microvillus membrane expression of DMT1 in intestinal epithelial cells in a PKCα-dependent manner. FASEB J. 2019;33:3549-3561 pubmed publisher
van Raaij S, van Swelm R, Bouman K, Cliteur M, van den Heuvel M, Pertijs J, et al. Tubular iron deposition and iron handling proteins in human healthy kidney and chronic kidney disease. Sci Rep. 2018;8:9353 pubmed publisher
Ma W, Lu J, Jiang S, Cai D, Pan S, Jia Y, et al. Maternal protein restriction depresses the duodenal expression of iron transporters and serum iron level in male weaning piglets. Br J Nutr. 2017;117:923-929 pubmed publisher
Montalbetti N, Simonin A, Simonin C, Awale M, Reymond J, Hediger M. Discovery and characterization of a novel non-competitive inhibitor of the divalent metal transporter DMT1/SLC11A2. Biochem Pharmacol. 2015;96:216-24 pubmed publisher
Montalbetti N, Simonin A, Dalghi M, Kovacs G, Hediger M. Development and Validation of a Fast and Homogeneous Cell-Based Fluorescence Screening Assay for Divalent Metal Transporter 1 (DMT1/SLC11A2) Using the FLIPR Tetra. J Biomol Screen. 2014;19:900-8 pubmed publisher
Hansen S, Trakooljul N, Liu H, Hicks J, Ashwell M, Spears J. Proteins involved in iron metabolism in beef cattle are affected by copper deficiency in combination with high dietary manganese, but not by copper deficiency alone. J Anim Sci. 2010;88:275-83 pubmed publisher
Howitt J, Putz U, Lackovic J, Doan A, Dorstyn L, Cheng H, et al. Divalent metal transporter 1 (DMT1) regulation by Ndfip1 prevents metal toxicity in human neurons. Proc Natl Acad Sci U S A. 2009;106:15489-94 pubmed publisher
Barth S, Edlich F, Berchner Pfannschmidt U, Gneuss S, Jahreis G, Hasgall P, et al. Hypoxia-inducible factor prolyl-4-hydroxylase PHD2 protein abundance depends on integral membrane anchoring of FKBP38. J Biol Chem. 2009;284:23046-58 pubmed publisher
Foot N, Dalton H, Shearwin Whyatt L, Dorstyn L, Tan S, Yang B, et al. Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2. Blood. 2008;112:4268-75 pubmed publisher

product information

brand :

Novus

master code :

H00004891-M01

SKU :

H00004891-M01

product name :

NRAMP2/SLC11A2/DMT1 Antibody (4C6)

description :

The NRAMP2/SLC11A2/DMT1 Antibody (4C6) from Novus Biologicals is a mouse monoclonal antibody to NRAMP2/SLC11A2/DMT1. This antibody reacts with human, mouse, porcine, bovine. The NRAMP2/SLC11A2/DMT1 Antibody (4C6) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA.

target :

NRAMP2/SLC11A2/DMT1

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4C6

conjugate :

Unconjugated

host :

Mouse

immunogen :

MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQS
PGDSEEYFATYFNEKISIPEEEYSCF
SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Mouse, Porcine, Bovine

specificity :

SLC11A2 - solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2

gene symbol :

SLC11A2

catalog number base :

H00004891-M01

accessionNumbers :

NP_000608

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

DCT1NRAMP 2, Divalent cation transporter 1, Divalent metal transporter 1, DMT-1, DMT1FLJ37416, member 2, NRAMP2natural resistance-associated macrophage protein 2, solute carrier family 11 (proton-coupled divalent metal ion transporters)

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.